y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi2g25310.1
FamilyGH20
Protein PropertiesLength: 522 Molecular Weight: 57700.2 Isoelectric Point: 7.3226
ChromosomeChromosome/Scaffold: 2 Start: 23236815 End: 23242436
Descriptionbeta-hexosaminidase 3
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH201634720
  MDMSRFPYRGLLIDTARHYLPVPVIKSVIDSMTYSKLNVLHWHIVDEQSFPLEIPSYPKLSNGAYSYSEKYTINDALDIVQYAEKRGVNVLAEIDVPGHA
  RSWGVGYPSLWPSASCQQPLDVSNNFTFKVIDGILSDFSKVFKFKFVHLGGDEVNTSCWTTTPRIKSWLVQHGMNESDAYRYFVLRAQKIAISHGYDIIN
  WEETFNNFGDKLDRKTVVHNWLGGGVAEKVVSAGLRCIVSNQDKWYLDHLDATWEGFYMNEPLTNIYNPEQQKLILGGEVCMWGERIDASDIQQTIWPRA
  AAAAERLWTP
Full Sequence
Protein Sequence     Length: 522     Download
MALRLVLALA LVGCAAAAAA GRVDLWPMPA SVSSGAKTLY VAKDLKLSAT GSKYADGKAI    60
LAEAFKRMVA VVQMDHAVNG SYRGLPVLAG VNVVVRSPDD ELKFGVDESY KLSVPATGNP    120
MYAQIEAQTV FGALHALETF SQLCYFDFVL RVTGLHSAPW TIMDMSRFPY RGLLIDTARH    180
YLPVPVIKSV IDSMTYSKLN VLHWHIVDEQ SFPLEIPSYP KLSNGAYSYS EKYTINDALD    240
IVQYAEKRGV NVLAEIDVPG HARSWGVGYP SLWPSASCQQ PLDVSNNFTF KVIDGILSDF    300
SKVFKFKFVH LGGDEVNTSC WTTTPRIKSW LVQHGMNESD AYRYFVLRAQ KIAISHGYDI    360
INWEETFNNF GDKLDRKTVV HNWLGGGVAE KVVSAGLRCI VSNQDKWYLD HLDATWEGFY    420
MNEPLTNIYN PEQQKLILGG EVCMWGERID ASDIQQTIWP RAAAAAERLW TPVEKLAKGA    480
TVVTARLARF RCLLNERGVA AAPLAGYGRT APLEPGSCIR Q*                       540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd02742GH20_hexosaminidase8.0e-58170470322+
cd06563GH20_chitobiase-like5.0e-67168475354+
cd06570GH20_chitobiase-like_13.0e-73168472323+
pfam00728Glyco_hydro_202.0e-105168472335+
cd06562GH20_HexA_HexB-like4.0e-156168498350+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004563beta-N-acetylhexosaminidase activity
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAT77374.102352127527putative beta-N-acetylhexosaminidase [Oryza sativa Japonica Group]
GenBankACN36154.102352127525unknown [Zea mays]
GenBankEEC79230.102352127527hypothetical protein OsI_19972 [Oryza sativa Indica Group]
RefSeqNP_001045052.101452119526Os01g0891000 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001055557.102352131531Os05g0415700 [Oryza sativa (japonica cultivar-group)]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2gk1_H0255077501B Chain B, X-Ray Crystal Structure Of Ngt-Bound Hexa
PDB2gk1_F0255077501B Chain B, X-Ray Crystal Structure Of Ngt-Bound Hexa
PDB2gk1_D0255077501B Chain B, X-Ray Crystal Structure Of Ngt-Bound Hexa
PDB2gk1_B0255077501B Chain B, X-Ray Crystal Structure Of Ngt-Bound Hexa
PDB2gjx_G0255077501B Chain B, X-Ray Crystal Structure Of Ngt-Bound Hexa
Metabolic Pathways
Pathway NameReactionECProtein Name
chitin degradation IIRXN-12625EC-3.2.1.52β-L-N-acetylhexosaminidase
chitin degradation IIRXN-12626EC-3.2.1.52β-L-N-acetylhexosaminidase
Signal Peptide
Cleavage Site
17
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CK2104943191975150
GO8454713201414600
CJ6779852751994730
ES3024942851043880
JG9347422792305080
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_022_00071.4Aquca_022_00071.3Aquca_022_00071.2Aquca_022_00071.1Aquca_010_00682.1
Aquca_004_00645.1
Arabidopsis lyrata475658485946470561
Arabidopsis thalianaAT1G65590.1AT3G55260.1AT1G05590.1
Brachypodium distachyonBradi2g57420.1Bradi2g37460.1Bradi3g44607.1Bradi1g69660.1Bradi1g23740.1
Brassica rapaBra004121Bra014765Bra032460
Carica papayaevm.model.supercontig_197.26
Capsella rubellaCarubv10020116mCarubv10016974mCarubv10011603m
Chlamydomonas reinhardtiig11709.t1
Citrus clementinaCiclev10014808mCiclev10031174mCiclev10031139mCiclev10031669mCiclev10033772m
Ciclev10019509mCiclev10024601m
Citrus sinensisorange1.1g008945morange1.1g013337morange1.1g008821morange1.1g014971morange1.1g044344m
orange1.1g007722morange1.1g007610m
Cucumis sativusCucsa.165600.1Cucsa.178740.1Cucsa.165600.2.144.314Cucsa.165600.2.144.314Cucsa.177460.1
Cucsa.165600.2.312.421Cucsa.165600.2.312.421
Eucalyptus grandisEucgr.G02896.1Eucgr.L01476.1Eucgr.K02799.2Eucgr.K02799.1Eucgr.K02799.3
Eucgr.K02798.2Eucgr.K02798.1
Fragaria vescamrna26730.1-v1.0-hybridmrna02330.1-v1.0-hybrid
Glycine maxGlyma18g52290.1Glyma02g10570.1Glyma10g43710.1Glyma20g38400.1Glyma08g17200.1
Glyma08g16970.1Glyma15g41986.1
Gossypium raimondiiGorai.002G136400.2Gorai.002G136400.1Gorai.011G246500.1Gorai.012G068200.1Gorai.012G068200.2
Gorai.002G136400.3Gorai.012G068200.3Gorai.007G264000.1
Linum usitatissimumLus10003292Lus10030323Lus10022251Lus10030348Lus10007899
Malus domesticaMDP0000798095MDP0000262060.270.444MDP0000262060.270.444MDP0000564236MDP0000262060.174.257
MDP0000262060.174.257
Manihot esculentacassava4.1_033827mcassava4.1_033064mcassava4.1_004406mcassava4.1_007813mcassava4.1_023099m
cassava4.1_021615m
Medicago truncatulaMedtr2g062560.1
Mimulus guttatusmgv1a004365mmgv1a003720mmgv1a007861mmgv1a003512mmgv1a023788m
Oryza sativaLOC_Os01g66700.1LOC_Os05g34320.2LOC_Os05g34320.1LOC_Os05g02510.1LOC_Os05g34320.3
LOC_Os07g38790.1LOC_Os03g11980.1
Panicum virgatumPavirv00023753mPavirv00005093mPavirv00062644mPavirv00067910mPavirv00063863m
Pavirv00062646mPavirv00001875mPavirv00056279mPavirv00062645m.258.396Pavirv00062645m.258.396
Pavirv00060770mPavirv00016511mPavirv00054866mPavirv00049460mPavirv00062645m.174.254
Pavirv00062645m.174.254
Physcomitrella patensPp1s70_132V6.1Pp1s3_199V6.1
Phaseolus vulgarisPhvul.008G015400.1Phvul.007G010100.1Phvul.005G045300.1Phvul.005G043200.1
Picea abiesMA_177334g0010MA_271570g0010MA_92690g0010.179.289MA_92690g0010.179.289MA_92690g0010.297.429
MA_92690g0010.297.429
Populus trichocarpaPotri.008G079400.2Potri.008G079400.1Potri.010G211000.2Potri.010G211000.1Potri.010G211000.4
Potri.010G211000.3Potri.008G079400.5Potri.008G079400.3Potri.008G079400.4Potri.001G232800.1
Potri.001G232600.1
Prunus persicappa003880mppa002753m
Ricinus communis29929.m00450328180.m00037729616.m00021628180.m00037634575.m000024
47890.m000013
Setaria italicaSi001028mSi021738mSi024695mSi021693mSi029311m
Si034794m
Selaginella moellendorffii117332429308422139422155445016
422160429325441789422260
Sorghum bicolorSb09g020420.2Sb09g020420.1Sb09g001670.1Sb02g037280.1Sb01g042640.1
Thellungiella halophilaThhalv10018379mThhalv10010264mThhalv10007181mThhalv10007179m
Vitis viniferaGSVIVT01016639001GSVIVT01006264001GSVIVT01004010001GSVIVT01006000001
Volvox carteriVocar20013124m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)