y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi2g26170.1
FamilyGH13
Protein PropertiesLength: 808 Molecular Weight: 88274.6 Isoelectric Point: 6.2752
ChromosomeChromosome/Scaffold: 2 Start: 24502983 End: 24505514
Descriptiondebranching enzyme 1
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH133126406e-27
  NVAGTFSGMAAKIDHFRSLGVNAVLLEPVFPFHKEKGPYFPYHFFSPMNSYSSEGCSASAITSMKDMVKAMHKNGIEVLLEVVFTHTAEGEADCQMISIR
  GIDSFSYYIADEIVGCNVGILNCNSPVTQKLILDSLRHWVLDFHVDGFCFINAPFLLRGPCGEYLSRPPLLESIAFDPVLSKTKIIADPWSPLGISNVQF
  PFPHWKRWAEMNTRFSIDVRKFLKGEALISDLATRLCGSGDLFSSRGPAFSFNSVSRNSGLTLVDLVSFSNDDLASESSWNCGEEGPSENSAVLQTRLRQ
  IRNFIFILFVSLGIPVLNMGDECGHSSGG
Full Sequence
Protein Sequence     Length: 808     Download
MAYLLAPPAS WRGVRPPAPP RQSAPRHGLI SRAARSSCYR FRTDDDGVVD VAVARKEGEG    60
GGYTVSVQVP LLPGSARGRE GGRLVLRPAD SGEGFALAPA VSSGGDGACL AAELSFDASR    120
APFNLSFLLT DGEGAEIWTH RKTTFRVPVG VRRGSPAPLG MSLSDDGAAN FALYSKTAKG    180
VVLCLYDGKG SDEPALEIEL DPYVNRTGNV WHVLLDCVQG YISYGFRCGL LGTGHPLLDP    240
YAKVLGDFLS ANSVYVEGVP VQSMSFLGSL ANAPSYNWGR DKHPCLPFEK LVVYRANVAL    300
FTKDKSAELP DNVAGTFSGM AAKIDHFRSL GVNAVLLEPV FPFHKEKGPY FPYHFFSPMN    360
SYSSEGCSAS AITSMKDMVK AMHKNGIEVL LEVVFTHTAE GEADCQMISI RGIDSFSYYI    420
ADEIVGCNVG ILNCNSPVTQ KLILDSLRHW VLDFHVDGFC FINAPFLLRG PCGEYLSRPP    480
LLESIAFDPV LSKTKIIADP WSPLGISNVQ FPFPHWKRWA EMNTRFSIDV RKFLKGEALI    540
SDLATRLCGS GDLFSSRGPA FSFNSVSRNS GLTLVDLVSF SNDDLASESS WNCGEEGPSE    600
NSAVLQTRLR QIRNFIFILF VSLGIPVLNM GDECGHSSGG STLYMDRVPL NWKGLKTTFV    660
KEVTAFISFL AALRSRRGDI FQRREFLKLE NIYWHGKDLS EPRWEDPTSK FLCMHVIAEN    720
DGNMPDSTKG DLYICFNANE ESISATLPAP AEGSMWLCLV DTSLALPGFF ATESNPKVQQ    780
VPGYSSYEVK AHSCVLFESK RDLSLLL*                                       840
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK03705PRK037054.0e-80151676584+
cd11326AmyAc_Glg_debranch8.0e-126276676450+
COG1523PulA5.0e-128151805722+
TIGR02100glgX_debranch2.0e-128154797721+
cd11346AmyAc_plant_IsoA3.0e-152287682403+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0043169cation binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAT93894.102580427800putative isoamylase-type starch debranching enzyme ISO2 [Oryza sativa Japonica Group]
DDBJBAD08581.101807179785kDa isoamylase [Hordeum vulgare subsp. vulgare]
EMBLCAX51369.1018071797isoamylase [Hordeum vulgare subsp. vulgare]
GenBankEAY96723.103780478840hypothetical protein OsI_18641 [Oryza sativa Indica Group]
RefSeqXP_002441051.102980433800hypothetical protein SORBIDRAFT_09g019480 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vuy_B015179712713A Chain A, Crystal Structure Of The Eukaryotic Clamp Loader (Replication Factor C, Rfc) Bound To The Dna Sliding Clamp (Proliferating Cell Nuclear Antigen, Pcna)
PDB2vuy_A015179712713A Chain A, Crystal Structure Of The Eukaryotic Clamp Loader (Replication Factor C, Rfc) Bound To The Dna Sliding Clamp (Proliferating Cell Nuclear Antigen, Pcna)
PDB2vr5_B015179712713A Chain A, Crystal Structure Of The Eukaryotic Clamp Loader (Replication Factor C, Rfc) Bound To The Dna Sliding Clamp (Proliferating Cell Nuclear Antigen, Pcna)
PDB2vr5_A015179712713A Chain A, Crystal Structure Of The Eukaryotic Clamp Loader (Replication Factor C, Rfc) Bound To The Dna Sliding Clamp (Proliferating Cell Nuclear Antigen, Pcna)
PDB2vnc_B015179712713A Chain A, Crystal Structure Of Glycogen Debranching Enzyme Trex From Sulfolobus Solfataricus
Metabolic Pathways
Pathway NameReactionECProtein Name
starch degradation IIRXN-12280EC-3.2.1.68isoamylase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO7984613134647760
GO7957883054978010
CK2066642943326250
JG9317532814196990
JG8967592803826610
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00091.4Aquca_014_00091.1Aquca_014_00091.3Aquca_014_00091.2Aquca_014_00091.5
Aquca_014_00091.6Aquca_014_00091.7Aquca_018_00158.1Aquca_018_00158.2Aquca_014_00091.8
Aquca_026_00010.1
Arabidopsis lyrata911044483030470308
Arabidopsis thalianaAT4G09020.1AT2G39930.1AT1G03310.2AT1G03310.1
Brachypodium distachyonBradi4g32707.2Bradi4g32707.1Bradi3g40410.2Bradi3g40410.1
Brassica rapaBra000667Bra005001Bra030528Bra033388
Carica papayaevm.model.supercontig_36.185evm.model.supercontig_485.4evm.model.supercontig_115.45
Capsella rubellaCarubv10003443mCarubv10024947mCarubv10012076m
Chlamydomonas reinhardtiig4436.t1g3160.t1
Citrus clementinaCiclev10000452mCiclev10000347mCiclev10007489mCiclev10023436m
Citrus sinensisorange1.1g009902morange1.1g006791morange1.1g003977morange1.1g011993morange1.1g005976m
orange1.1g003653morange1.1g003901morange1.1g005552morange1.1g047308m
Cucumis sativusCucsa.311690.1Cucsa.281840.2Cucsa.281840.1Cucsa.084930.1
Eucalyptus grandisEucgr.B00043.1Eucgr.C02189.3Eucgr.C02189.2Eucgr.C02189.1Eucgr.K03392.1
Fragaria vescamrna11912.1-v1.0-hybridmrna12022.1-v1.0-hybridmrna27855.1-v1.0-hybrid
Glycine maxGlyma06g10540.2Glyma04g10693.3Glyma04g10693.2Glyma04g10693.1Glyma08g03210.2
Glyma08g03210.1Glyma03g30771.1Glyma19g33620.2
Gossypium raimondiiGorai.009G233800.1Gorai.009G233800.2Gorai.009G233800.3Gorai.012G008800.3Gorai.012G008800.2
Gorai.012G008800.1Gorai.007G134600.3Gorai.007G134600.2Gorai.007G134600.1
Linum usitatissimumLus10036474Lus10021586Lus10000661Lus10027999Lus10017150
Malus domesticaMDP0000119748MDP0000118987MDP0000313388MDP0000185233MDP0000647541
MDP0000258604MDP0000238431
Manihot esculentacassava4.1_001932mcassava4.1_001414m
Medicago truncatulaMedtr3g099500.1Medtr8g101490.1
Mimulus guttatusmgv1a002417mmgv1a001549mmgv1a001869m
Oryza sativaLOC_Os08g40930.1LOC_Os09g29404.3LOC_Os09g29404.1LOC_Os05g32710.1
Panicum virgatumPavirv00034683mPavirv00034682mPavirv00063957mPavirv00032505mPavirv00012813m
Physcomitrella patensPp1s25_63V6.1Pp1s36_254V6.2Pp1s36_254V6.1Pp1s62_201V6.2
Phaseolus vulgarisPhvul.009G033200.1Phvul.002G303600.1Phvul.001G148700.1Phvul.005G040300.1
Picea abiesMA_10431226g0020MA_159157g0180
Populus trichocarpaPotri.002G100900.2Potri.002G100900.4Potri.002G100900.3Potri.002G100900.1Potri.006G070800.3
Potri.006G070800.2Potri.006G070800.1Potri.018G132500.4Potri.018G132500.3Potri.018G132500.2
Potri.018G132500.1Potri.018G132500.5Potri.002G215400.1Potri.002G219900.1
Prunus persicappa001639mppa025097mppa001199m
Ricinus communis29908.m00608929776.m00048828153.m00028728323.m00004135877.m000015
27724.m00001829104.m000024
Setaria italicaSi029005mSi013277m
Selaginella moellendorffii10621875877414611
Sorghum bicolorSb02g027280.3Sb02g027280.2Sb02g027280.1Sb07g027200.1Sb09g019480.1
Thellungiella halophilaThhalv10028487mThhalv10028455mThhalv10028452mThhalv10016275mThhalv10006762m
Vitis viniferaGSVIVT01009087001GSVIVT01035168001GSVIVT01011096001
Volvox carteriVocar20007238mVocar20007651m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)