y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi2g26600.1
FamilyGH2
Protein PropertiesLength: 980 Molecular Weight: 110545 Isoelectric Point: 6.3791
ChromosomeChromosome/Scaffold: 2 Start: 25278631 End: 25286856
Descriptionglycoside hydrolase family 2 protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH2427690
  TSATAPWMHAAVPGTVLGTLLKNKLIPDPFYGLNNQAIIDIADSGREHYTFWFFTTFQCAPVGNQHVSLNFRGINYSAEVYLNGHEEVLPKGMFRRHTLD
  ITDVLHPDGNNLLAVLVHPPDHPGTIPPGGGQGGDHEIGKDVATQYVEGWDWICPIRDRNTGIWDEVSISITGPLKIADPHLVSTFHDDFKRSYLHCTLQ
  LENKSSWSADCTLKIQVSTEVEGNVCLVEHLQNYAITINPHSVLEYTIPPLFFYKPNLWWPNGMGKQSLYNVEISIDINGFGESDSWSHYFGFRKIESTI
  DDSTGGRIFKVNGEPIFIRGGNWILSDGLLRLTKKRYMTDIKFHADMNFNMIRCWGGGLAERPDFYHFCDVYGLMVWQEFWITGDVDGRGVPVSNPDGPL
  DHGLFLLCARDTVKLLRNHASLALWVGGNEQVPPVDINKTLKNDLKLHPMFISYQRTKAQKICLSQDSSDPSKYLDGTRVYVQGSMWDGFANGKGGWSDG
  PYEIQYPESFFKDSFYKYGFNPEVGSVGVPVAATIRATMPPEGWNIPIFKKNIDGYIKEIPNPIWDYHKYIPYSKPGKVHDQIELYGRPEDLDDFCEKAQ
  LVNYVQYRALLEGWTSFMWTKFTGVLIWKTQNPWTGLRGQFYDHLQDQTAGFYGCRCAAEPIHVQLNLASFFIEVVNTTSNELTNVAVEISIWDLDGASP
  YYKVTEKMVVPPKKVKQIMEMEYPKMKN
Full Sequence
Protein Sequence     Length: 980     Download
MSAAEAAAAV GKRVLDTGWL AARSTEVALT GVELTTTHPP DTSATAPWMH AAVPGTVLGT    60
LLKNKLIPDP FYGLNNQAII DIADSGREHY TFWFFTTFQC APVGNQHVSL NFRGINYSAE    120
VYLNGHEEVL PKGMFRRHTL DITDVLHPDG NNLLAVLVHP PDHPGTIPPG GGQGGDHEIG    180
KDVATQYVEG WDWICPIRDR NTGIWDEVSI SITGPLKIAD PHLVSTFHDD FKRSYLHCTL    240
QLENKSSWSA DCTLKIQVST EVEGNVCLVE HLQNYAITIN PHSVLEYTIP PLFFYKPNLW    300
WPNGMGKQSL YNVEISIDIN GFGESDSWSH YFGFRKIEST IDDSTGGRIF KVNGEPIFIR    360
GGNWILSDGL LRLTKKRYMT DIKFHADMNF NMIRCWGGGL AERPDFYHFC DVYGLMVWQE    420
FWITGDVDGR GVPVSNPDGP LDHGLFLLCA RDTVKLLRNH ASLALWVGGN EQVPPVDINK    480
TLKNDLKLHP MFISYQRTKA QKICLSQDSS DPSKYLDGTR VYVQGSMWDG FANGKGGWSD    540
GPYEIQYPES FFKDSFYKYG FNPEVGSVGV PVAATIRATM PPEGWNIPIF KKNIDGYIKE    600
IPNPIWDYHK YIPYSKPGKV HDQIELYGRP EDLDDFCEKA QLVNYVQYRA LLEGWTSFMW    660
TKFTGVLIWK TQNPWTGLRG QFYDHLQDQT AGFYGCRCAA EPIHVQLNLA SFFIEVVNTT    720
SNELTNVAVE ISIWDLDGAS PYYKVTEKMV VPPKKVKQIM EMEYPKMKNA KPVYFLLLKL    780
VRLSDKEVLS RNFYWLHLPG KDYKLLEQYR QKTVPLKIGS KVYVSGRAYT VRMSIENRSN    840
KSTAESATSV STMDLVDGNG SNSISEETIC EGQETGLWSK IRRGIDLARS GDKPRTVEVN    900
GTDSGVAFFL HFSVHNSESS TQENYRDTRI LPVHYSDNYF SLTPGEKMTV DISFEAPEGS    960
VPRVILRGWN YHLYHAVTM*                                                1020
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK10150PRK101500.00292471422+
pfam02837Glyco_hydro_2_N8.0e-89115970+
PRK10340ebgA2.0e-11105471388+
pfam00703Glyco_hydro_22.0e-12218335118+
COG3250LacZ3.0e-3352677654+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEEC79162.101097916985hypothetical protein OsI_19836 [Oryza sativa Indica Group]
RefSeqNP_001055444.101197916984Os05g0391500 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002319539.1089772972predicted protein [Populus trichocarpa]
RefSeqXP_002439742.1079792978hypothetical protein SORBIDRAFT_09g019350 [Sorghum bicolor]
RefSeqXP_002512381.1089772972beta-mannosidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vzo_B0679630767A Chain A, Crystal Structure Of Amycolatopsis Orientalis Exo- Chitosanase Csxa
PDB2vzo_A0679630767A Chain A, Crystal Structure Of Amycolatopsis Orientalis Exo- Chitosanase Csxa
PDB2x09_B0679630767A Chain A, Crystal Structure Of Amycolatopsis Orientalis Exo- Chitosanase Csxa
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO8476393465248690
GO8716003333076390
ES7939203823807570
GO8481593171764920
GT0484363385659010
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00437.1Aquca_017_00437.4Aquca_054_00086.1Aquca_017_00437.2Aquca_017_00437.5
Aquca_017_00437.3
Arabidopsis lyrata888134
Arabidopsis thalianaAT1G09010.1
Brassica rapaBra018587Bra030751
Carica papayaevm.model.supercontig_48.57
Capsella rubellaCarubv10008228m
Citrus clementinaCiclev10000150mCiclev10000160m
Citrus sinensisorange1.1g045314m
Cucumis sativusCucsa.182080.2Cucsa.182080.1
Eucalyptus grandisEucgr.H04490.2Eucgr.H04490.1Eucgr.H04490.3
Fragaria vescamrna22540.1-v1.0-hybrid
Glycine maxGlyma10g29550.1Glyma20g37760.1Glyma03g39810.1Glyma19g42370.1
Gossypium raimondiiGorai.013G124100.1Gorai.007G297200.2Gorai.007G297200.1Gorai.007G297200.3Gorai.007G297200.4
Linum usitatissimumLus10029917Lus10004484
Malus domesticaMDP0000300462MDP0000144916MDP0000026514MDP0000210658
Manihot esculentacassava4.1_001014m
Medicago truncatulaMedtr7g113570.1Medtr1g082890.1
Mimulus guttatusmgv1a023381mmgv1a000882mmgv1a024358m
Oryza sativaLOC_Os05g32530.1
Panicum virgatumPavirv00050693mPavirv00063196mPavirv00063197m
Physcomitrella patensPp1s2985_1V6.1Pp1s99_248V6.1Pp1s114_165V6.1
Phaseolus vulgarisPhvul.007G180100.1Phvul.006G092100.1
Picea abiesMA_10427468g0010
Populus trichocarpaPotri.013G021200.4Potri.013G021200.3Potri.013G021200.1Potri.013G021200.2
Prunus persicappa000875mppa000882m
Ricinus communis30128.m008776
Setaria italicaSi021098m
Selaginella moellendorffii164536
Sorghum bicolorSb09g019350.1
Thellungiella halophilaThhalv10006730m
Vitis viniferaGSVIVT01000073001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny