y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi2g26850.1
FamilyGT77
Protein PropertiesLength: 352 Molecular Weight: 39415.6 Isoelectric Point: 9.6048
ChromosomeChromosome/Scaffold: 2 Start: 25634582 End: 25638739
DescriptionNucleotide-diphospho-sugar transferase family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT771153310
  DQVLVIAEDYETLERINAAWPGHAVLIPPAPDAQAAHKFGSQGFFNFTSRRPRHLLQILELGYSVMYNDVDMVWLADPFPYLVGNHDVYFMDDMTDVKAL
  NHSHELPPPGKKGRPYICSCMIFLQPTEGAKLLMRKWIEELKEQPWSKKVKSNDQPAFNWALLKTVGQVDVYLLPQSAFPTGGLYFKNKTWVKETKGKHV
  IIHNNYITGFEKKIKRF
Full Sequence
Protein Sequence     Length: 352     Download
MSLHQRPHQK PLAADSLHVS TGPASSAPSR PLPLLTLPYL FSLLALLLLL ALLFPWGPPR    60
HSSPASPWRA YTLQDAAAFA AAAGNGTIVL AAVSGPYLPF LSNWLISVRR AGRADQVLVI    120
AEDYETLERI NAAWPGHAVL IPPAPDAQAA HKFGSQGFFN FTSRRPRHLL QILELGYSVM    180
YNDVDMVWLA DPFPYLVGNH DVYFMDDMTD VKALNHSHEL PPPGKKGRPY ICSCMIFLQP    240
TEGAKLLMRK WIEELKEQPW SKKVKSNDQP AFNWALLKTV GQVDVYLLPQ SAFPTGGLYF    300
KNKTWVKETK GKHVIIHNNY ITGFEKKIKR FRDHKLWLVD EHSDESPLGK L*            360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03407Nucleotid_trans2.0e-44115331222+
Gene Ontology
GO TermDescription
GO:0005783endoplasmic reticulum
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN69309.106335123309hypothetical protein [Vitis vinifera]
GenBankEAY97881.1013511352hypothetical protein OsI_19800 [Oryza sativa Indica Group]
RefSeqNP_001055421.1013511352Os05g0386900 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001143398.1013511353hypothetical protein LOC100276040 [Zea mays]
RefSeqXP_002439724.1013511352hypothetical protein SORBIDRAFT_09g019070 [Sorghum bicolor]
Transmembrane Domains
StartEnd
3557
78100
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CT85910935113490
DY264723271593290
FC914138262593200
HX158583200842830
DY294483273593310
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_074_00044.1
Arabidopsis lyrata352664892838490401474813912111
Arabidopsis thalianaAT4G01220.1AT1G56550.1AT4G01750.1AT4G01220.2AT4G01770.1
Brassica rapaBra035432Bra036306Bra000906Bra039864Bra017900
Bra037377Bra000950Bra035431Bra000907
Carica papayaevm.model.supercontig_184.13
Capsella rubellaCarubv10001259mCarubv10001249mCarubv10021691m
Citrus clementinaCiclev10020808mCiclev10022071mCiclev10021218m
Citrus sinensisorange1.1g018302morange1.1g027009morange1.1g021054m
Cucumis sativusCucsa.135840.2Cucsa.135840.1
Eucalyptus grandisEucgr.E00084.1
Fragaria vescamrna09360.1-v1.0-hybrid
Glycine maxGlyma08g09360.1
Gossypium raimondiiGorai.004G154200.4Gorai.007G104400.1Gorai.004G154200.1Gorai.004G154200.5Gorai.004G154200.3
Gorai.004G154200.2
Linum usitatissimumLus10002153Lus10012650Lus10008735
Malus domesticaMDP0000150593MDP0000264889
Manihot esculentacassava4.1_010616mcassava4.1_010633m
Mimulus guttatusmgv1a008876m
Oryza sativaLOC_Os05g32120.1
Panicum virgatumPavirv00063401mPavirv00048789m
Physcomitrella patensPp1s19_296V6.1
Phaseolus vulgarisPhvul.002G188500.1
Picea abiesMA_10233136g0010MA_173768g0010
Populus trichocarpaPotri.014G092400.2Potri.002G166000.1Potri.014G092400.1
Prunus persicappa007793m
Ricinus communis30174.m008682
Setaria italicaSi022588mSi017632m
Selaginella moellendorffii87970
Sorghum bicolorSb09g019070.1
Thellungiella halophilaThhalv10029467mThhalv10015591mThhalv10024021mThhalv10024115mThhalv10028748m
Vitis viniferaGSVIVT01016220001GSVIVT01027019001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny