y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi2g31690.1
FamilyGH5
Protein PropertiesLength: 516 Molecular Weight: 56815.9 Isoelectric Point: 7.1638
ChromosomeChromosome/Scaffold: 2 Start: 31604263 End: 31608022
DescriptionCellulase (glycosyl hydrolase family 5) protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH52235011.69557e-43
  PVLRNHWSTYIVEEDFRFISASGLTAVRIPVGWWIASDPNPPAPYVGGSLKILDRAFKWAEKYNLGVIVDLHAAPGSQNPWEHSSSRDGTQEWGTKDANI
  AETVQVIEFLASRYAKSPSFLAMELMNEPLAPKTSFESLTKYYRDGYDAVRRHSSGAYVIMSNRLGTGGNTTELLGFAGGFNGAVLDVHYYTVFNSMFDN
  FTVQQNIDFIRTNFSSDLGSITAQNGPLTFVGEWVAEWKVPNAAKEEYQKYAKAQMDVYGQATFGWSYWTLKNVNDHWN
Full Sequence
Protein Sequence     Length: 516     Download
MARRRSVVHD VSLLLLCFCW LCSLSQAKRT PSSKSSFRLP VRAVCLGGWL VTEGWILPSL    60
FDGIPNKDLL DGTQLQFKSA ARGMYLAAEQ GGGAAVSANR AQASGWETFK LWRINETTFN    120
FKVFGGQFVS VGSDGTVVAT AALPGPSEAF QIVRNAGDKN RTRIRAPNGA FLQAKKDGSV    180
TADYGESTSW GDDDPSVFAV TKAGELQGEY QICNGYGTSK ATPVLRNHWS TYIVEEDFRF    240
ISASGLTAVR IPVGWWIASD PNPPAPYVGG SLKILDRAFK WAEKYNLGVI VDLHAAPGSQ    300
NPWEHSSSRD GTQEWGTKDA NIAETVQVIE FLASRYAKSP SFLAMELMNE PLAPKTSFES    360
LTKYYRDGYD AVRRHSSGAY VIMSNRLGTG GNTTELLGFA GGFNGAVLDV HYYTVFNSMF    420
DNFTVQQNID FIRTNFSSDL GSITAQNGPL TFVGEWVAEW KVPNAAKEEY QKYAKAQMDV    480
YGQATFGWSY WTLKNVNDHW NMEWMINNGF ISLKS*                              540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00257Fascin1.0e-1173183111+
pfam00150Cellulase8.0e-13213456250+
COG2730BglC2.0e-28200510347+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0030674protein binding, bridging
GO:0051015actin filament binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEAY97220.103751541518hypothetical protein OsI_19139 [Oryza sativa Indica Group]
GenBankEEE62967.102051519546hypothetical protein OsJ_17774 [Oryza sativa Japonica Group]
RefSeqNP_001055011.102051519525Os05g0244500 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001150774.1055148538cellulase containing protein [Zea mays]
RefSeqXP_002440848.102151423538hypothetical protein SORBIDRAFT_09g008170 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1eqp_A8e-3519551126378A Chain A, Exo-B-(1,3)-Glucanase From Candida Albicans
PDB1eqc_A1e-3419551126378A Chain A, Exo-B-(1,3)-Glucanase From Candida Albicans
PDB1cz1_A1e-3419551126378A Chain A, Exo-B-(1,3)-Glucanase From Candida Albicans At 1.85 A Resolution
Signal Peptide
Cleavage Site
27
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EG3886702811634430
CJ7223622851594430
FF3576472831614430
DN829598266292940
CB643027276843580
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_010_00111.1Aquca_010_00110.1
Brachypodium distachyonBradi3g38500.1
Carica papayaevm.model.supercontig_55.63evm.model.supercontig_66.87evm.model.supercontig_20.222
Citrus clementinaCiclev10025463mCiclev10026955mCiclev10025415mCiclev10000913m
Citrus sinensisorange1.1g009560morange1.1g046395morange1.1g019395morange1.1g013777morange1.1g010600m
orange1.1g009475m
Cucumis sativusCucsa.104180.2Cucsa.104180.1
Eucalyptus grandisEucgr.I00417.1Eucgr.L01170.1Eucgr.L02139.1Eucgr.I00543.1Eucgr.I00415.1
Eucgr.F00486.1Eucgr.F00489.1Eucgr.F00489.3Eucgr.F00489.2Eucgr.F00487.1
Eucgr.L01169.1Eucgr.F00488.1Eucgr.I00415.2
Fragaria vescamrna16220.1-v1.0-hybridmrna16368.1-v1.0-hybridmrna22085.1-v1.0-hybridmrna16374.1-v1.0-hybrid
Glycine maxGlyma11g37881.1Glyma18g01781.2Glyma18g01781.3Glyma18g01781.1Glyma06g47761.6
Glyma06g47761.1Glyma06g47761.5Glyma06g47761.2Glyma06g47761.8Glyma06g47761.4
Glyma06g47761.7Glyma06g47761.3Glyma13g02030.2Glyma06g47750.1Glyma13g02000.1
Glyma08g14676.1Glyma05g31460.1Glyma14g34450.1
Gossypium raimondiiGorai.009G239600.6Gorai.009G239600.5Gorai.009G239600.4Gorai.009G239600.1Gorai.009G239600.3
Gorai.009G239600.2Gorai.009G239600.7Gorai.011G110800.2Gorai.011G110800.1Gorai.003G041900.1
Gorai.003G044300.1Gorai.003G044000.4Gorai.003G044000.5Gorai.003G044200.1Gorai.003G044000.3
Gorai.003G044000.2Gorai.003G044000.1
Linum usitatissimumLus10041110Lus10036436
Malus domesticaMDP0000319015MDP0000123200MDP0000133367
Manihot esculentacassava4.1_007845mcassava4.1_026104mcassava4.1_006238m
Medicago truncatulaMedtr3g009020.1Medtr3g086750.1Medtr3g009030.1Medtr5g062290.1Medtr3g008960.1
Medtr5g062190.1Medtr3g009010.1Medtr8g091310.1
Mimulus guttatusmgv1a004896mmgv1a019918m
Oryza sativaLOC_Os10g22570.1.193.483LOC_Os10g22570.1.193.483LOC_Os10g22570.1.193.483LOC_Os10g22520.1LOC_Os10g22570.1.671.954
LOC_Os10g22570.1.671.954LOC_Os10g22570.1.671.954LOC_Os05g15510.2LOC_Os05g15510.1LOC_Os08g37750.1
Panicum virgatumPavirv00046245mPavirv00011301mPavirv00018291mPavirv00046244mPavirv00011300m
Pavirv00028658mPavirv00000970mPavirv00042459mPavirv00046564m
Physcomitrella patensPp1s304_43V6.1
Phaseolus vulgarisPhvul.001G254400.1Phvul.008G171300.1Phvul.002G261800.1Phvul.008G171400.1
Picea abiesMA_10427061g0010MA_479818g0010MA_4911g0010MA_14445g0010MA_23595g0010
Populus trichocarpaPotri.007G010000.1Potri.005G167800.1Potri.007G089400.1Potri.007G089400.2Potri.005G078500.1
Potri.002G093000.1
Prunus persicappa023601mppa005425mppa019648m
Ricinus communis29810.m00014529908.m00599427889.m00017327905.m00007336339.m000016
Setaria italicaSi035257mSi006205mSi021695mSi021671mSi039329m
Si013558mSi035337m
Selaginella moellendorffii12682742658240418324801
Sorghum bicolorSb10g007500.1Sb09g008170.1Sb01g024390.1Sb10g008480.1
Vitis viniferaGSVIVT01003438001GSVIVT01006372001GSVIVT01006369001GSVIVT01002801001GSVIVT01008995001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)