y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi2g33090.1
FamilyGT31
Protein PropertiesLength: 377 Molecular Weight: 41996.8 Isoelectric Point: 6.8272
ChromosomeChromosome/Scaffold: 2 Start: 33124438 End: 33129851
DescriptionGalactosyltransferase family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT311313220
  RAALRATWFPPNPEGIVSVEHRFGLSFRFVIGRTNDKEKMADLQKEVDLYHDFLFIDVEEGTKSPQKMLAYFKAAYDMFDAEFYIKADDAIYLRPDRLAA
  LLAKDRPHHRTYIGCMKKGPVVSDPNMKWYESSWGLLGNEYFMHASGSLYALSSEVVGGLATAKNDSLRMFDYEDVTIGSWMLAMNVKHEDN
Full Sequence
Protein Sequence     Length: 377     Download
MPLHHPKHRH HHDEDVLPYH RSDDEAKPRR PYAPSSFPTS PASPASAHRF LFLFAVVCLL    60
LAVASLAFAV SVIRRPAPLQ PPPTSVVFRC GRAEDSLRSF LASSQNYSTG DREKVLAVVG    120
VHTELGSAAL RAALRATWFP PNPEGIVSVE HRFGLSFRFV IGRTNDKEKM ADLQKEVDLY    180
HDFLFIDVEE GTKSPQKMLA YFKAAYDMFD AEFYIKADDA IYLRPDRLAA LLAKDRPHHR    240
TYIGCMKKGP VVSDPNMKWY ESSWGLLGNE YFMHASGSLY ALSSEVVGGL ATAKNDSLRM    300
FDYEDVTIGS WMLAMNVKHE DNRAMCDSTC TPTSIAVWDS KTCSGSCNPV GKIKELHNTT    360
LCSKSPTLPP DVEEEE*                                                   420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam01762Galactosyl_T1.0e-33137323195+
PLN03193PLN031936.0e-40112357263+
Gene Ontology
GO TermDescription
GO:0006486protein glycosylation
GO:0008378galactosyltransferase activity
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_001054878.102537525390Os05g0199500 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001131152.1013761375hypothetical protein LOC100192460 [Zea mays]
RefSeqXP_002279252.107137163359PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002308559.107437164362predicted protein [Populus trichocarpa]
RefSeqXP_002440764.1013761375hypothetical protein SORBIDRAFT_09g006190 [Sorghum bicolor]
Transmembrane Domains
StartEnd
5072
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GT8280131941843770
CO4441202351423750
FF5827201921793700
GT8195671702083770
EX3725632711023710
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_081_00004.1
Arabidopsis lyrata474455901308897766
Arabidopsis thalianaAT1G53290.1AT3G14960.1AT2G26100.1
Brachypodium distachyonBradi1g48880.1
Brassica rapaBra027291Bra038114Bra001576Bra034289
Carica papayaevm.model.supercontig_97.96
Capsella rubellaCarubv10023358mCarubv10009980mCarubv10009620mCarubv10014091m
Citrus clementinaCiclev10020877mCiclev10008876mCiclev10010334m
Citrus sinensisorange1.1g018669morange1.1g018637morange1.1g020201m
Cucumis sativusCucsa.122670.1Cucsa.122670.2
Eucalyptus grandisEucgr.F03260.2Eucgr.F03260.1Eucgr.F03260.5Eucgr.F01224.1Eucgr.F03260.3
Eucgr.F03260.4Eucgr.C03050.1
Fragaria vescamrna27228.1-v1.0-hybridmrna02689.1-v1.0-hybrid
Glycine maxGlyma13g34630.1Glyma06g33880.1Glyma20g09170.1
Gossypium raimondiiGorai.009G368400.1Gorai.009G368400.2Gorai.010G100900.1Gorai.002G062000.1
Linum usitatissimumLus10014451Lus10023955Lus10013683
Malus domesticaMDP0000323739MDP0000306900MDP0000237443
Manihot esculentacassava4.1_010336mcassava4.1_011023m
Mimulus guttatusmgv1a009062m
Oryza sativaLOC_Os06g06280.1LOC_Os06g06280.2LOC_Os05g11060.1LOC_Os05g11060.2
Panicum virgatumPavirv00018938mPavirv00043119mPavirv00019539mPavirv00061117mPavirv00048022m
Pavirv00036678m
Physcomitrella patensPp1s34_219V6.1Pp1s65_64V6.1
Phaseolus vulgarisPhvul.005G067100.1Phvul.011G159800.1
Picea abiesMA_10428560g0010MA_10426473g0010
Populus trichocarpaPotri.006G228900.3Potri.006G228900.4Potri.006G228900.1Potri.006G228900.2Potri.011G111700.2
Potri.011G111700.1Potri.001G392700.1
Prunus persicappa007915mppa007437m
Ricinus communis30150.m00048629794.m003321
Setaria italicaSi022377mSi006727m
Selaginella moellendorffii5630166328
Sorghum bicolorSb09g006190.1Sb10g003920.1
Thellungiella halophilaThhalv10021058mThhalv10002018mThhalv10011624m
Vitis viniferaGSVIVT01035404001GSVIVT01014218001
Volvox carteriVocar20001878m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)