y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi2g36297.1
FamilyGT1
Protein PropertiesLength: 491 Molecular Weight: 52797.2 Isoelectric Point: 5.5308
ChromosomeChromosome/Scaffold: 2 Start: 36678939 End: 36680411
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT1484605.8e-32
  AAFVRAGLSALVGPDDDDDDSAVVVVELEFPADGAHGVPRGVESAGGLTSVTSIVPFVHAVSLLQPQLDAALQAAQDTSPVSLLIADPFLHWANASAARI
  GVPRVSFFATSMFMHVMQEELVPRHNPFASLRPGEMDNHGNPTSWAVPEFPHIRFTFEDLIAPLGDDPAMVELGSKVLETINGSHGLIVNSSHVLEGSYI
  DFWNNQHLGPKAWPVGPLCCLSPKTTNGGGPRPPWMEWLDSKQASGHAILYIALGTMSAKPEPQLRALADGLERAGVGFIWPVRPEDIDLGAGFKERTKG
  RGLVVREWVDQPEILRHPSVQGFLTHCGWNSILEGVTAGVPMAAWPMNSDQPFHAKLVVDDLRIAVRSVRTSDGTLRGPVTGEEISELVRELMLGEAGIE
  AAKKAAELSALAK
Full Sequence
Protein Sequence     Length: 491     Download
MGSSVLPHVA LFPFLAKGHT IPYIQLAHRC RCRRLATVTF FTTRGSNAAF VRAGLSALVG    60
PDDDDDDSAV VVVELEFPAD GAHGVPRGVE SAGGLTSVTS IVPFVHAVSL LQPQLDAALQ    120
AAQDTSPVSL LIADPFLHWA NASAARIGVP RVSFFATSMF MHVMQEELVP RHNPFASLRP    180
GEMDNHGNPT SWAVPEFPHI RFTFEDLIAP LGDDPAMVEL GSKVLETING SHGLIVNSSH    240
VLEGSYIDFW NNQHLGPKAW PVGPLCCLSP KTTNGGGPRP PWMEWLDSKQ ASGHAILYIA    300
LGTMSAKPEP QLRALADGLE RAGVGFIWPV RPEDIDLGAG FKERTKGRGL VVREWVDQPE    360
ILRHPSVQGF LTHCGWNSIL EGVTAGVPMA AWPMNSDQPF HAKLVVDDLR IAVRSVRTSD    420
GTLRGPVTGE EISELVRELM LGEAGIEAAK KAAELSALAK DAMAEGGSSW NALEEMIAAL    480
CVQRNIQENN *                                                         540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN00164PLN001644.0e-36233487276+
PLN02448PLN024484.0e-46125440331+
PLN02534PLN025343.0e-507414427+
PLN02863PLN028633.0e-588441458+
PLN03007PLN030072.0e-598484506+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEAZ08642.10648115495hypothetical protein OsI_30915 [Oryza sativa Indica Group]
GenBankEAZ08646.10648514484hypothetical protein OsI_30917 [Oryza sativa Indica Group]
RefSeqNP_001062897.10648115494Os09g0329200 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001062898.10984851385Os09g0329700 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002462233.10348412479hypothetical protein SORBIDRAFT_02g022230 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2pq6_A5.04467e-4474859482A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vg8_A9e-35231473207460A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vch_A9e-35231473207460A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
Metabolic Pathways
Pathway NameReactionECProtein Name
curcumin glucoside biosynthesisRXN-7062EC-2.4.1UDP-glucose:curcumin glucosyltransferase
curcumin glucoside biosynthesisRXN-7063EC-2.4.1UDP-glucose:curcumin monoglucoside glucosyltransferase
gentiodelphin biosynthesisRXN-8231EC-2.4.1.238anthocyanin 3'-O-β-glucosyltransferase
gentiodelphin biosynthesisRXN-8234EC-2.4.1UDP-D-glucose:delphinidin 3-O-glucosyl-5-O-caffeoylglucoside -O-β-D-glucosyltransferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CT85210635663530
FL8829602421924330
HO1778842282574810
DT6533172592314800
EB4072772362154410
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_025_00292.1Aquca_025_00293.1Aquca_002_00206.1Aquca_004_00007.1Aquca_004_00008.1
Aquca_004_00009.1Aquca_031_00060.1
Arabidopsis lyrata480568874994350625471154
Arabidopsis thalianaAT2G16890.2AT5G14860.1AT1G10400.1
Brachypodium distachyonBradi2g36325.1Bradi4g28210.1Bradi1g43760.1Bradi1g37120.1Bradi2g08147.1
Brassica rapaBra006271Bra008734Bra013043Bra018440
Capsella rubellaCarubv10013583mCarubv10003019mCarubv10013609mCarubv10016193mCarubv10012329m
Carubv10016195m
Citrus clementinaCiclev10015105m
Citrus sinensisorange1.1g019791morange1.1g048238m
Cucumis sativusCucsa.158560.1Cucsa.158600.1
Eucalyptus grandisEucgr.A01139.1Eucgr.J03156.1Eucgr.J03158.1Eucgr.J03155.1Eucgr.J03157.1
Eucgr.J03154.1
Fragaria vescamrna08733.1-v1.0-hybridmrna28389.1-v1.0-hybrid
Glycine maxGlyma16g08060.1
Gossypium raimondiiGorai.001G265200.1
Linum usitatissimumLus10022222Lus10022220Lus10022221Lus10026927Lus10026926
Lus10020124
Malus domesticaMDP0000575823MDP0000576836MDP0000159916MDP0000261158MDP0000296033
MDP0000800689MDP0000942526MDP0000691324MDP0000130487MDP0000203647
MDP0000865084
Manihot esculentacassava4.1_022533mcassava4.1_025192mcassava4.1_007045m
Mimulus guttatusmgv1a005626mmgv1a026899m
Oryza sativaLOC_Os06g39070.1LOC_Os09g16090.1LOC_Os09g16030.1LOC_Os09g21160.1LOC_Os04g24110.1
LOC_Os06g16000.1LOC_Os05g42040.1LOC_Os06g39080.1LOC_Os06g08830.1
Panicum virgatumPavirv00038352mPavirv00070294mPavirv00062203mPavirv00046074mPavirv00058520m
Pavirv00020575mPavirv00042658mPavirv00025139mPavirv00067592mPavirv00016340m
Pavirv00034420mPavirv00017568mPavirv00037090m
Physcomitrella patensPp1s15_417V6.2Pp1s15_417V6.1
Phaseolus vulgarisPhvul.007G048100.1Phvul.008G151900.1
Populus trichocarpaPotri.018G009000.1Potri.001G348100.1Potri.006G272600.1Potri.006G272500.2Potri.006G272500.1
Potri.018G008900.1Potri.005G036100.1
Prunus persicappa005107mppa023458mppa017646m
Ricinus communis29822.m00335529822.m003356
Setaria italicaSi033411mSi033010mSi006359mSi020900mSi006267m
Si006185m
Sorghum bicolorSb10g005950.1Sb02g022230.1Sb02g023640.1Sb02g023632.1Sb10g009810.1
Sb10g022980.1
Thellungiella halophilaThhalv10022679mThhalv10015356m
Vitis viniferaGSVIVT01016138001
Zea maysAC234524.1_FGT005
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)