y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi2g37460.1
FamilyGH20
Protein PropertiesLength: 544 Molecular Weight: 60167.5 Isoelectric Point: 5.8315
ChromosomeChromosome/Scaffold: 2 Start: 37774436 End: 37779957
Descriptionbeta-hexosaminidase 1
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH201824920
  IQDEPRFAFRGLLLDTSRHYLPVDVIKQVIDSMSFAKLNVLHWHIIDEQSFPLEIPSYPNLWKGSYSKLERYTVEDAHYIVSYAKKRGIHVMAEIDVPGH
  GESWGNGYPKLWPSISCTEPLDVSSNFTFEVLSGILSDMRKIFPFGLFHLGGDEVNTGCWNITPHVKQWLDDRNMTTKDAYKFFVLKAQEIAINLNWIPV
  NWEETFNSFGENLNPLTVVHNWLGPGVCPKVVAKGLRCIMSNQGAWYLDHLDVPWEDVYTTEPLAGINDTEQQKLVLGGEVCMWGETADTSDVQQTIWPR
  AAAAAERMWSP
Full Sequence
Protein Sequence     Length: 544     Download
MLPKLLTYLV LALVAGSGAG AGAARLHRTP ANLTASANPV YIWPLPKNFT SGTRTLAVDP    60
DLALDPQGPG GAAAAVAEAF ERYRSLIFAP WAHAARPASA KYDVAKLTVV VASADETLEL    120
GVDESYTIYV AASGGVNSIV GGATIEANTI YGAIRGLETF SQLCVFNYDT KNVEVHNAPW    180
YIQDEPRFAF RGLLLDTSRH YLPVDVIKQV IDSMSFAKLN VLHWHIIDEQ SFPLEIPSYP    240
NLWKGSYSKL ERYTVEDAHY IVSYAKKRGI HVMAEIDVPG HGESWGNGYP KLWPSISCTE    300
PLDVSSNFTF EVLSGILSDM RKIFPFGLFH LGGDEVNTGC WNITPHVKQW LDDRNMTTKD    360
AYKFFVLKAQ EIAINLNWIP VNWEETFNSF GENLNPLTVV HNWLGPGVCP KVVAKGLRCI    420
MSNQGAWYLD HLDVPWEDVY TTEPLAGIND TEQQKLVLGG EVCMWGETAD TSDVQQTIWP    480
RAAAAAERMW SPLEAISVQD QTIVLARLHY FRCLLNHRGI AAAPVTNYYA RRPPIHPGSC    540
FIQ*                                                                 600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd02742GH20_hexosaminidase3.0e-57191491322+
cd06570GH20_chitobiase-like_11.0e-66188500330+
cd06563GH20_chitobiase-like3.0e-67188495354+
pfam00728Glyco_hydro_206.0e-98188492335+
cd06562GH20_HexA_HexB-like3.0e-147188519351+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004563beta-N-acetylhexosaminidase activity
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEEE62107.105354333524hypothetical protein OsJ_16891 [Oryza sativa Japonica Group]
RefSeqNP_001054468.102554322541Os05g0115900 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001147583.102354323545LOC100281192 [Zea mays]
RefSeqXP_002316315.103854325531predicted protein [Populus trichocarpa]
RefSeqXP_002440479.102554326546hypothetical protein SORBIDRAFT_09g001670 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1o7a_F0285253505A Chain A, Human Beta-Hexosaminidase B
PDB1o7a_E0285253505A Chain A, Human Beta-Hexosaminidase B
PDB1o7a_D0285253505A Chain A, Human Beta-Hexosaminidase B
PDB1o7a_C0285253505A Chain A, Human Beta-Hexosaminidase B
PDB1o7a_B0285253505A Chain A, Human Beta-Hexosaminidase B
Metabolic Pathways
Pathway NameReactionECProtein Name
chitin degradation IIRXN-12625EC-3.2.1.52β-L-N-acetylhexosaminidase
chitin degradation IIRXN-12626EC-3.2.1.52β-L-N-acetylhexosaminidase
Signal Peptide
Cleavage Site
20
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO8484723311244540
HO8039823981475440
GO8548293221394600
GO8634853291895160
GO863485151791937.5
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_022_00071.4Aquca_022_00071.3Aquca_022_00071.2Aquca_022_00071.1Aquca_010_00682.1
Aquca_004_00645.1
Arabidopsis lyrata475658485946470561
Arabidopsis thalianaAT1G65590.1AT3G55260.1AT1G05590.1
Brachypodium distachyonBradi2g57420.1Bradi2g25310.1Bradi3g44607.1Bradi1g69660.1Bradi1g23740.1
Brassica rapaBra004121Bra014765Bra032460
Carica papayaevm.model.supercontig_197.26
Capsella rubellaCarubv10020116mCarubv10016974mCarubv10011603m
Chlamydomonas reinhardtiig11709.t1
Citrus clementinaCiclev10014808mCiclev10031174mCiclev10031139mCiclev10031669mCiclev10033772m
Ciclev10019509mCiclev10024601m
Citrus sinensisorange1.1g008945morange1.1g013337morange1.1g008821morange1.1g014971morange1.1g044344m
orange1.1g007722morange1.1g007610m
Cucumis sativusCucsa.165600.1Cucsa.178740.1Cucsa.165600.2.144.314Cucsa.165600.2.144.314Cucsa.177460.1
Cucsa.165600.2.312.421Cucsa.165600.2.312.421
Eucalyptus grandisEucgr.G02896.1Eucgr.L01476.1Eucgr.K02799.2Eucgr.K02799.1Eucgr.K02799.3
Eucgr.K02798.2Eucgr.K02798.1
Fragaria vescamrna26730.1-v1.0-hybridmrna02330.1-v1.0-hybrid
Glycine maxGlyma18g52290.1Glyma02g10570.1Glyma10g43710.1Glyma20g38400.1Glyma08g17200.1
Glyma08g16970.1Glyma15g41986.1
Gossypium raimondiiGorai.002G136400.2Gorai.002G136400.1Gorai.011G246500.1Gorai.012G068200.1Gorai.012G068200.2
Gorai.002G136400.3Gorai.012G068200.3Gorai.007G264000.1
Linum usitatissimumLus10003292Lus10030323Lus10022251Lus10030348Lus10007899
Malus domesticaMDP0000798095MDP0000262060.270.444MDP0000262060.270.444MDP0000564236MDP0000262060.174.257
MDP0000262060.174.257
Manihot esculentacassava4.1_033827mcassava4.1_033064mcassava4.1_004406mcassava4.1_007813mcassava4.1_023099m
cassava4.1_021615m
Medicago truncatulaMedtr2g062560.1
Mimulus guttatusmgv1a004365mmgv1a003720mmgv1a007861mmgv1a003512mmgv1a023788m
Oryza sativaLOC_Os01g66700.1LOC_Os05g34320.2LOC_Os05g34320.1LOC_Os05g02510.1LOC_Os05g34320.3
LOC_Os07g38790.1LOC_Os03g11980.1
Panicum virgatumPavirv00023753mPavirv00005093mPavirv00062644mPavirv00067910mPavirv00063863m
Pavirv00062646mPavirv00001875mPavirv00056279mPavirv00062645m.258.396Pavirv00062645m.258.396
Pavirv00060770mPavirv00016511mPavirv00054866mPavirv00049460mPavirv00062645m.174.254
Pavirv00062645m.174.254
Physcomitrella patensPp1s70_132V6.1Pp1s3_199V6.1
Phaseolus vulgarisPhvul.008G015400.1Phvul.007G010100.1Phvul.005G045300.1Phvul.005G043200.1
Picea abiesMA_177334g0010MA_271570g0010MA_92690g0010.179.289MA_92690g0010.179.289MA_92690g0010.297.429
MA_92690g0010.297.429
Populus trichocarpaPotri.008G079400.2Potri.008G079400.1Potri.010G211000.2Potri.010G211000.1Potri.010G211000.4
Potri.010G211000.3Potri.008G079400.5Potri.008G079400.3Potri.008G079400.4Potri.001G232800.1
Potri.001G232600.1
Prunus persicappa003880mppa002753m
Ricinus communis29929.m00450328180.m00037729616.m00021628180.m00037634575.m000024
47890.m000013
Setaria italicaSi001028mSi021738mSi024695mSi021693mSi029311m
Si034794m
Selaginella moellendorffii117332429308422139422155445016
422160429325441789422260
Sorghum bicolorSb09g020420.2Sb09g020420.1Sb09g001670.1Sb02g037280.1Sb01g042640.1
Thellungiella halophilaThhalv10018379mThhalv10010264mThhalv10007181mThhalv10007179m
Vitis viniferaGSVIVT01016639001GSVIVT01006264001GSVIVT01004010001GSVIVT01006000001
Volvox carteriVocar20013124m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)