y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi2g39450.1
FamilyGH35
Protein PropertiesLength: 567 Molecular Weight: 61339.8 Isoelectric Point: 7.4279
ChromosomeChromosome/Scaffold: 2 Start: 39508137 End: 39510726
Descriptionbeta-galactosidase 15
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH35311750
  LVIDGERRIIVSGSIHYPRSTPEMWPELIRKAKEGGLDAIETYVFWNGHEPRKRQVLNITTSRASTTYAILRIGPYICGEWNYGGLPAWLRDISGMQFRM
  HNDPFEKKMETFTSLIVAKLKEAKLFAGQGGPIILSQFEDRDVNV
Full Sequence
Protein Sequence     Length: 567     Download
MDRILPLLLL AAAAVVLGAG GTEISHNNRA LVIDGERRII VSGSIHYPRS TPEMWPELIR    60
KAKEGGLDAI ETYVFWNGHE PRKRQVLNIT TSRASTTYAI LRIGPYICGE WNYGGLPAWL    120
RDISGMQFRM HNDPFEKKME TFTSLIVAKL KEAKLFAGQG GPIILSQFED RDVNVTLDDG    180
ATHVIVPAWS VSILPGCKAV AYNTARIKTQ TSVMAKKPHQ LPETTTAAGQ QQPMWSWMPE    240
NLAPFMTDEK GSFRKNELLE QITTSADESD YLWYRTSFEH KGEASYKLHV NTTGHELYAF    300
VNGKLVGKHH SPNGGFVFQL ETPVKLHSGK NYISLLSATI GLKNYGALFE MMPAGIVGGP    360
VKLIKTTSNT TAMDLSNSSW SYKSGLAGEY RSIHLDGDDT RQQWQSLNGT IPVHRPFTWY    420
KATFSAPAGS EPVVADLLGL GKGVAWVNGH NLGRYWPSYE AGGDPSAAAF KTVGVGAACV    480
EGVQVGDDVA LACGGHGRTI SSVDVASVGV TRGRCGGAYE GGCESEKALE ALKKACVGKE    540
SCTVRHTEEF LVAAGVSGEL TVQVTC*                                        600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam02140Gal_Lectin1.0e-749156683+
COG1874LacA2.0e-1124121107+
PLN03059PLN030592.0e-5524193179+
PLN03059PLN030591.0e-59170566475+
pfam01301Glyco_hydro_351.0e-6230169149+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005529Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates." [CHEBI:16646, GOC:mah]
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACN27651.1051754183unknown [Zea mays]
GenBankACN27651.10155566365821unknown [Zea mays]
GenBankEEE50782.10163566381828hypothetical protein OsJ_31141 [Oryza sativa Japonica Group]
RefSeqNP_001043252.102017527191Os01g0533400 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001043252.10163566381827Os01g0533400 [Oryza sativa (japonica cultivar-group)]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3thd_D9e-202317110165A Chain A, Structure Of The Catalytic Domain Of Human Bile Salt Activated Lipase
PDB3thd_D0.001333458450571A Chain A, Structure Of The Catalytic Domain Of Human Bile Salt Activated Lipase
PDB3thd_C9e-202317110165A Chain A, Structure Of The Catalytic Domain Of Human Bile Salt Activated Lipase
PDB3thd_C0.001333458450571A Chain A, Structure Of The Catalytic Domain Of Human Bile Salt Activated Lipase
PDB3thd_B9e-202317110165A Chain A, Structure Of The Catalytic Domain Of Human Bile Salt Activated Lipase
Metabolic Pathways
Pathway NameReactionECProtein Name
lactose degradation IIIBETAGALACTOSID-RXNEC-3.2.1.23β-galactosidase
Signal Peptide
Cleavage Site
18
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FL8149222282354610
CJ6549261902654530
FL8149232092814820
FL7676981962944820
FL767698172772932.3