y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi2g44942.1
FamilyCE10
Protein PropertiesLength: 410 Molecular Weight: 45184.5 Isoelectric Point: 8.5234
ChromosomeChromosome/Scaffold: 2 Start: 45326419 End: 45332549
Descriptionprenylcysteine methylesterase
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE101123740
  QVRRSIVYGEQPRNRLDLYIPKDNTRPCPVMAFVTGGAWIIGYKAWGALLGRRLAERGIIVACIDYRNFPQGTISDMVADASQGISFVCNNIASYGGDPN
  QIYLMGQSAGAHIAACALMEQAVKESSGQPISWSVTQIKAYFGLSGGYNIYNLVDHFHQRGLYRSIFLSIMDGEESLSRYSPEIVVKESSPQTIALLPPI
  VLMHGTDDYSIPSSASQTFVDVLQQVGAQARLLLYEGKTHTDIFLQDPLRGGKDPLVEDVLSV
Full Sequence
Protein Sequence     Length: 410     Download
MQPPSSGGDA READALLARS DSAGRRRRAS PVQSASPAPQ GWGGPRRQSS FRDDVGHAAS    60
ETYLVTRLTF TLLQYLGLGY RWMTQLLALA VYAILLMPGF LQVGYYYFFS SQVRRSIVYG    120
EQPRNRLDLY IPKDNTRPCP VMAFVTGGAW IIGYKAWGAL LGRRLAERGI IVACIDYRNF    180
PQGTISDMVA DASQGISFVC NNIASYGGDP NQIYLMGQSA GAHIAACALM EQAVKESSGQ    240
PISWSVTQIK AYFGLSGGYN IYNLVDHFHQ RGLYRSIFLS IMDGEESLSR YSPEIVVKES    300
SPQTIALLPP IVLMHGTDDY SIPSSASQTF VDVLQQVGAQ ARLLLYEGKT HTDIFLQDPL    360
RGGKDPLVED VLSVIHTDDA TRRNIASAPT PRRLVFEWQL QLARRISPF*               420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam07859Abhydrolase_33.0e-8147351211+
cd00312Esterase_lipase3.0e-10127248142+
pfam00135COesterase3.0e-12127226119+
COG2272PnbA6.0e-13127230122+
COG0657Aes1.0e-22114351243+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016787hydrolase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEEC71166.10784094342hypothetical protein OsI_03031 [Oryza sativa Indica Group]
GenBankEEE55068.1014091409hypothetical protein OsJ_02788 [Oryza sativa Japonica Group]
RefSeqNP_001043688.1013261325Os01g0642000 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001056406.1014091414Os05g0577200 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001132117.10124097404hypothetical protein LOC100193534 [Zea mays]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1jmy_A0.000000000811122267197A Chain A, Truncated Recombinant Human Bile Salt Stimulated Lipase
PDB1c7i_A0.00000000211623769215A Chain A, Thermophylic Pnb Esterase
PDB1qe3_A0.00000000211623769215A Chain A, Pnb Esterase
PDB1c7j_A0.00000000311623769215A Chain A, Pnb Esterase 56c8
PDB1f6w_A0.00000000311122167196A Chain A, Structure Of The Catalytic Domain Of Human Bile Salt Activated Lipase
Transmembrane Domains
StartEnd
87109
139161
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FE6100662521564060
FL959136246713160
JG945758265853490
DY280956288453310
GE479256299803750
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01054.1Aquca_026_00158.1Aquca_002_01054.2Aquca_002_01054.3
Arabidopsis lyrata472805488435871523
Arabidopsis thalianaAT5G15860.1AT3G02410.2AT3G02410.1AT1G26120.1AT5G15860.2
Brachypodium distachyonBradi1g34707.1Bradi2g15577.1
Brassica rapaBra023542Bra039174Bra024729Bra011010
Carica papayaevm.model.supercontig_179.40evm.model.supercontig_1.241
Capsella rubellaCarubv10009035mCarubv10013836mCarubv10001044m
Chlamydomonas reinhardtiiCre02.g119050.t1.3Cre02.g119100.t1.2Cre04.g221000.t1.2
Citrus clementinaCiclev10031407mCiclev10012228mCiclev10012226mCiclev10011876mCiclev10031505m
Ciclev10032121m
Citrus sinensisorange1.1g011866morange1.1g021014morange1.1g015512morange1.1g015857morange1.1g015669m
orange1.1g012898morange1.1g027370morange1.1g020616m
Cucumis sativusCucsa.284050.2Cucsa.284050.1Cucsa.031590.2Cucsa.031590.1Cucsa.031590.3
Cucsa.023750.1
Eucalyptus grandisEucgr.J01457.1Eucgr.B03069.1Eucgr.B03069.3Eucgr.B03069.2
Fragaria vescamrna10342.1-v1.0-hybridmrna04471.1-v1.0-hybrid
Glycine maxGlyma16g18930.1Glyma19g05450.1
Gossypium raimondiiGorai.013G079100.1Gorai.001G082500.7Gorai.001G082500.4Gorai.001G082500.3Gorai.001G082500.2
Gorai.001G082500.10Gorai.001G082500.1Gorai.001G082500.5Gorai.001G082500.8Gorai.001G082500.6
Gorai.013G079100.2Gorai.001G082500.9Gorai.001G082500.11
Linum usitatissimumLus10034399Lus10034083Lus10035064Lus10003065Lus10017889
Lus10019156
Malus domesticaMDP0000150270MDP0000199618MDP0000148927
Manihot esculentacassava4.1_007743mcassava4.1_008765m
Medicago truncatulaAC233657_38.1
Mimulus guttatusmgv1a005715mmgv1a006071mmgv1a007008m
Oryza sativaLOC_Os06g49440.1LOC_Os05g50170.2LOC_Os05g50170.1LOC_Os01g45460.1
Panicum virgatumPavirv00062556mPavirv00037181mPavirv00069964mPavirv00069963mPavirv00008713m
Pavirv00033569mPavirv00037182mPavirv00029918m
Physcomitrella patensPp1s196_45V6.1Pp1s62_226V6.1Pp1s74_172V6.1Pp1s131_174V6.1
Phaseolus vulgarisPhvul.003G282000.1Phvul.002G197000.1
Picea abiesMA_10277324g0010
Populus trichocarpaPotri.004G104800.4Potri.004G104800.2Potri.004G104800.1Potri.T099800.1Potri.017G110700.2
Potri.017G110700.1Potri.010G132200.3Potri.010G132200.2Potri.010G132200.1Potri.004G104800.3
Potri.010G132200.4Potri.004G104800.5
Prunus persicappa006567mppa005357m
Ricinus communis28583.m00011030138.m00382932825.m000025
Setaria italicaSi006248mSi001677mSi001674mSi025328m
Selaginella moellendorffii17024680622
Sorghum bicolorSb10g029410.1Sb03g029280.1
Thellungiella halophilaThhalv10013599mThhalv10020771mThhalv10007556m
Vitis viniferaGSVIVT01030706001GSVIVT01012000001
Volvox carteriVocar20003581mVocar20003648m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)