y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi2g48050.1
FamilyAA2
Protein PropertiesLength: 361 Molecular Weight: 38633.6 Isoelectric Point: 6.5062
ChromosomeChromosome/Scaffold: 2 Start: 48374248 End: 48375555
DescriptionPeroxidase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA2853410
  AADSNVAAALVRLFFHDCFVHGCDASVLLGRANGATKSERDAAPNRSLRGFGAVDKIKARLEKECPETVSCADILALAARDSLVLVGGPSYPVLTGRRDS
  AGSFYRDVNVPPPNATYAMTLDSFARHGFTERETVALLGAHSIGKVQCRFFRDRIYNFAGTGEPDDSIDRDMVSEMRAVCGGDGRAPMEMGYYRQGREVG
  FGAHYYAKLLAGRGILRSDQQLTAGSTVRWVRMYASERGEEAFREDFAHAMVKLSAL
Full Sequence
Protein Sequence     Length: 361     Download
MPRRPVRGTI CFLAISLLLC TDAGRPSYAL QLLGDDEDAD GGDGSTSFSF SSPQTTPGGL    60
AFGFYDGTCP GAEETVASTV RELYAADSNV AAALVRLFFH DCFVHGCDAS VLLGRANGAT    120
KSERDAAPNR SLRGFGAVDK IKARLEKECP ETVSCADILA LAARDSLVLV GGPSYPVLTG    180
RRDSAGSFYR DVNVPPPNAT YAMTLDSFAR HGFTERETVA LLGAHSIGKV QCRFFRDRIY    240
NFAGTGEPDD SIDRDMVSEM RAVCGGDGRA PMEMGYYRQG REVGFGAHYY AKLLAGRGIL    300
RSDQQLTAGS TVRWVRMYAS ERGEEAFRED FAHAMVKLSA LAPLTGSAGQ VRITCSKPAV    360
*                                                                    420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00314plant_peroxidase_like2.0e-2174339284+
pfam00141peroxidase6.0e-5976227154+
PLN03030PLN030304.0e-7659356303+
cd00693secretory_peroxidase9.0e-13959357305+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACF85842.10763582289unknown [Zea mays]
GenBankACF88167.1053587377unknown [Zea mays]
EMBLCAH69260.1033582364TPA: class III peroxidase 18 precursor [Oryza sativa (japonica cultivar-group)]
GenBankEEC71376.101235012356hypothetical protein OsI_03489 [Oryza sativa Indica Group]
RefSeqXP_002453827.1053607388hypothetical protein SORBIDRAFT_04g019270 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1qo4_A0643577302A Chain A, The Crystal Structure Of Flavodoxin From Desulfovibrio Gigas
PDB1pa2_A0643577302A Chain A, Arabidopsis Thaliana Peroxidase A2
PDB1sch_B0603572292A Chain A, Peanut Peroxidase
PDB1sch_A0603572292A Chain A, Peanut Peroxidase
PDB4a5g_B0583572303A Chain A, Raphanus Sativus Anionic Peroxidase.
Metabolic Pathways
Pathway NameReactionECProtein Name
betanidin degradationRXN-8635EC-1.11.1.7peroxidase
Signal Peptide
Cleavage Site
23
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EE286352216592690
EC897850199592530
EE184027196592500
EC894464194592480
EE176894192592460
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_024_00148.1Aquca_020_00226.1Aquca_020_00219.1Aquca_020_00225.1
Arabidopsis lyrata857184
Arabidopsis thalianaAT4G33870.1
Brassica rapaBra011475Bra024033
Carica papayaevm.model.supercontig_34.24evm.model.supercontig_98.23
Capsella rubellaCarubv10004951mCarubv10006531m
Citrus clementinaCiclev10025449mCiclev10017909mCiclev10026177m
Citrus sinensisorange1.1g035578morange1.1g043399morange1.1g016209m
Cucumis sativusCucsa.239780.1
Eucalyptus grandisEucgr.F01472.1Eucgr.F03025.1
Fragaria vescamrna29953.1-v1.0-hybridmrna29957.1-v1.0-hybridmrna29954.1-v1.0-hybrid
Glycine maxGlyma08g17850.2Glyma15g41280.1
Malus domesticaMDP0000486228MDP0000254277
Manihot esculentacassava4.1_025400m
Medicago truncatulaMedtr4g012870.1
Mimulus guttatusmgv1a019717m
Oryza sativaLOC_Os01g51550.1
Panicum virgatumPavirv00060522m
Phaseolus vulgarisPhvul.005G059500.1Phvul.005G059700.1
Picea abiesMA_177017g0010
Populus trichocarpaPotri.007G067200.1Potri.007G067200.2Potri.001G182400.1
Prunus persicappa018541mppa007961m
Ricinus communis30146.m00360130169.m006321
Setaria italicaSi003773m
Selaginella moellendorffii115533
Sorghum bicolorSb04g019270.1
Thellungiella halophilaThhalv10025607mThhalv10027558m.213.419Thhalv10027558m.213.419
Vitis viniferaGSVIVT01010156001GSVIVT01017084001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny