y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi2g50040.1
FamilyGT19
Protein PropertiesLength: 463 Molecular Weight: 51441.9 Isoelectric Point: 8.1741
ChromosomeChromosome/Scaffold: 2 Start: 49995945 End: 50003394
Descriptiontransferases, transferring glycosyl groups
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT19424230
  FVVAGEVSGDSLASRLMASIRELSPVPVRFAGVGGELMCKEGLQSLFPMEEIAIMGLWELLPHIYNVKRKIENTVDAAMLFQPHAVVTIDSKGFSFCLLQ
  QLKCRYNQKVDSPLHVHYVAPSFWAWKGGESRLSKLHNFVDHMLCILPFEHEICRLNGLPATYVGHPLLDDAAVLKVDPELSSDKSMHQESGEAFRLEHK
  LSPDATILTMLPGSRMQEVARMLPIFLRTVQHLSHTLNELSLVIPVAPHRDVRNYVENVVRSVPFPVVLIPGGSLEKRYGAFNASKAALCTSGTAVMELM
  LAKLPCVVAYQAHFITECFIHLRKKINFISLPNILLNSPIVPEILFRACTDKNLAAELSEVIFNDEVRQRQVGSADRMLQVL
Full Sequence
Protein Sequence     Length: 463     Download
MLSRWVAAAG RQQGLLARLR ARAYSYGRVF DAASRDGELR LFVVAGEVSG DSLASRLMAS    60
IRELSPVPVR FAGVGGELMC KEGLQSLFPM EEIAIMGLWE LLPHIYNVKR KIENTVDAAM    120
LFQPHAVVTI DSKGFSFCLL QQLKCRYNQK VDSPLHVHYV APSFWAWKGG ESRLSKLHNF    180
VDHMLCILPF EHEICRLNGL PATYVGHPLL DDAAVLKVDP ELSSDKSMHQ ESGEAFRLEH    240
KLSPDATILT MLPGSRMQEV ARMLPIFLRT VQHLSHTLNE LSLVIPVAPH RDVRNYVENV    300
VRSVPFPVVL IPGGSLEKRY GAFNASKAAL CTSGTAVMEL MLAKLPCVVA YQAHFITECF    360
IHLRKKINFI SLPNILLNSP IVPEILFRAC TDKNLAAELS EVIFNDEVRQ RQVGSADRML    420
QVLYEPIKQR GGSFVDEVRS LSSSVHSPST IAALTVLYTD KS*                      480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK01021lpxB3.0e-4042386351+
TIGR00215lpxB3.0e-5843433393+
pfam02684LpxB6.0e-8042438399+
COG0763LpxB9.0e-10539423385+
PRK00025lpxB1.0e-10739423387+
Gene Ontology
GO TermDescription
GO:0008915lipid-A-disaccharide synthase activity
GO:0009245lipid A biosynthetic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEEC71491.1014611467hypothetical protein OsI_03760 [Oryza sativa Indica Group]
RefSeqNP_001044267.1014611467Os01g0752600 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001140462.1014611463hypothetical protein LOC100272521 [Zea mays]
RefSeqXP_002458499.10214611443hypothetical protein SORBIDRAFT_03g034785 [Sorghum bicolor]
RefSeqXP_002528957.1054579464Lipid-A-disaccharide synthase, putative [Ricinus communis]
Metabolic Pathways
Pathway NameReactionECProtein Name
lipid IVA biosynthesisLIPIDADISACCHARIDESYNTH-RXNEC-2.4.1.182lipid-A-disaccharide synthase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
JG8640232771233990
DT65235027212720
DV51913627912790
DR96252726412640
DR96901826012600
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_006_00075.3Aquca_006_00075.2Aquca_006_00075.1
Arabidopsis lyrata480096
Arabidopsis thalianaAT2G04560.1
Brassica rapaBra015155.41.173Bra015155.41.173Bra015155.191.448Bra015155.191.448
Carica papayaevm.model.supercontig_132.41
Capsella rubellaCarubv10016120m
Citrus clementinaCiclev10018214m
Citrus sinensisorange1.1g024872morange1.1g016179m
Cucumis sativusCucsa.139770.1
Eucalyptus grandisEucgr.K00731.1
Fragaria vescamrna01138.1-v1.0-hybrid
Glycine maxGlyma02g11180.1
Gossypium raimondiiGorai.001G218100.1Gorai.001G218100.5Gorai.001G218100.6Gorai.001G218100.4Gorai.001G218100.3
Gorai.001G218100.2
Linum usitatissimumLus10035357Lus10029959
Malus domesticaMDP0000254582MDP0000227552
Manihot esculentacassava4.1_026066m
Mimulus guttatusmgv1a006184m
Oryza sativaLOC_Os01g54900.1
Panicum virgatumPavirv00020712mPavirv00034263mPavirv00034264mPavirv00034262m
Physcomitrella patensPp1s51_278V6.2Pp1s51_278V6.1Pp1s51_297V6.1Pp1s98_156V6.1
Phaseolus vulgarisPhvul.003G026900.1
Picea abiesMA_10428134g0010MA_159001g0240MA_10297492g0010
Populus trichocarpaPotri.014G160300.1
Prunus persicappa026476m
Ricinus communis56517.m00002234198.m00002229620.m000548
Selaginella moellendorffii405438
Sorghum bicolorSb03g034785.1
Thellungiella halophilaThhalv10002525m
Vitis viniferaGSVIVT01030530001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny