y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi2g50980.1
FamilyGH43
Protein PropertiesLength: 472 Molecular Weight: 54013.4 Isoelectric Point: 9.6155
ChromosomeChromosome/Scaffold: 2 Start: 50660948 End: 50664711
DescriptionArabinanase/levansucrase/invertase
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH431643841.7e-34
  KTAKYYWYGENKDGPTYQIHPEGAQRVDIIGVSCYSSEDLWSWTHEGIVLPGERTNITHDLHKSKVLERPKVIYNDRTKQYVMWMHIDDTNYTRASVGVA
  VSNSPTGTFTYLYSFRPHGFDSRDMTIFKDDDGKAYLFYSSRVNSELHVSPLTEDYLNITSAMRRILVRRFREAPAVFKFQGTYYMITSRCSGWAPNRAL
  AHATHSIMGPWETLGNPCVGG
Full Sequence
Protein Sequence     Length: 472     Download
MMVSKGRTKM RNRERKSSIL NFDAGCGSRL SFIVWGLLGF SLIVCLFFIS HQVETRHGRI    60
YSGHLPATRE LEEIEEEHFH LPPPHKVNPR AAKRRGPRKA SKIIDEYLDG TSAIHGMFFP    120
SQSTAMNPQR GGNDSMSFHP GRVWLDTDGN TIQAHGGGIL YDHKTAKYYW YGENKDGPTY    180
QIHPEGAQRV DIIGVSCYSS EDLWSWTHEG IVLPGERTNI THDLHKSKVL ERPKVIYNDR    240
TKQYVMWMHI DDTNYTRASV GVAVSNSPTG TFTYLYSFRP HGFDSRDMTI FKDDDGKAYL    300
FYSSRVNSEL HVSPLTEDYL NITSAMRRIL VRRFREAPAV FKFQGTYYMI TSRCSGWAPN    360
RALAHATHSI MGPWETLGNP CVGGNQFLRV TTFLSQSTFV LPLPGLPGTF IFMADRWNPS    420
NLRDSRYVWL PLSIGGLADE PVDYSFGFPL WPKVSIYWHR KWRLPEGWRK R*            480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd08999GH43_ABN_24.0e-16167380234+
cd09004GH43_bXyl4.0e-18159379230+
cd08990GH43_AXH_like4.0e-24197375193+
cd08978GH_F2.0e-37167434279+
cd08985GH43_66.0e-127152434284+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEAY76702.10146964532hypothetical protein OsI_04657 [Oryza sativa Indica Group]
RefSeqNP_001044987.1014691469Os01g0879400 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001151925.106946964465glycosyl hydrolase, family 43 protein [Zea mays]
RefSeqXP_002456734.1014691469hypothetical protein SORBIDRAFT_03g041630 [Sorghum bicolor]
RefSeqXP_002468324.106946963465hypothetical protein SORBIDRAFT_01g043810 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3vt2_F014143345329A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3vt2_E014143345329A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3vt2_D014143345329A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3vt2_C014143345329A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3vt2_B014143345329A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
Transmembrane Domains
StartEnd
3153
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO8561533351354690
FF3552542601544130
FF3503762631974590
GO8017532971724680
JG9067672731093810
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_060_00007.3Aquca_060_00007.1Aquca_060_00007.2
Arabidopsis lyrata906305332819
Arabidopsis thalianaAT5G67540.2AT5G67540.1AT3G49880.1
Brachypodium distachyonBradi2g50980.2Bradi1g71160.1
Brassica rapaBra024441Bra029980Bra036036
Capsella rubellaCarubv10027885mCarubv10019437m
Citrus clementinaCiclev10025553mCiclev10025552mCiclev10025561m
Citrus sinensisorange1.1g011114morange1.1g012300morange1.1g012453m
Cucumis sativusCucsa.366970.1Cucsa.366990.1
Eucalyptus grandisEucgr.I00703.2Eucgr.I00703.1Eucgr.H02307.1
Fragaria vescamrna05759.1-v1.0-hybrid
Glycine maxGlyma05g22470.3Glyma17g17390.3Glyma17g17390.2Glyma17g17390.1Glyma05g22470.6
Glyma05g22470.5Glyma05g22470.4Glyma05g22470.2Glyma01g40190.1Glyma11g05100.1
Gossypium raimondiiGorai.011G214500.1Gorai.008G083400.1Gorai.003G030500.1Gorai.003G030500.2
Linum usitatissimumLus10011543Lus10019280
Malus domesticaMDP0000248963MDP0000503275MDP0000406084
Manihot esculentacassava4.1_032973mcassava4.1_007150mcassava4.1_007066m
Medicago truncatulaMedtr5g015460.1Medtr4g097110.1
Mimulus guttatusmgv1a018781mmgv1a005746m
Oryza sativaLOC_Os12g21789.1LOC_Os12g21789.2LOC_Os01g65720.1
Panicum virgatumPavirv00010178mPavirv00067870mPavirv00058950mPavirv00044467m
Physcomitrella patensPp1s410_9V6.1Pp1s16_243V6.1
Phaseolus vulgarisPhvul.003G234900.1Phvul.002G010600.1
Picea abiesMA_181765g0010
Populus trichocarpaPotri.005G148800.1Potri.005G148800.2
Prunus persicappa005306m
Ricinus communis48021.m00001434138.m00001529661.m000924
Setaria italicaSi001388mSi035531m
Selaginella moellendorffii44066110234
Sorghum bicolorSb03g041630.1Sb01g043810.1
Thellungiella halophilaThhalv10004148mThhalv10010347m
Vitis viniferaGSVIVT01000105001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny