y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi2g52565.1
FamilyGH17
Protein PropertiesLength: 166 Molecular Weight: 17616.8 Isoelectric Point: 4.1645
ChromosomeChromosome/Scaffold: 2 Start: 51911345 End: 51912006
Descriptionbeta-1,3-glucanase 2
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1721650
  PVMAPLVSYLAERGSPLLVNAYPYFAYAADPASVPLDYALLSPSAAPAVTDDDGVQYVNMFDAIVDAVHAAVEKVTGSGQGVELVVSETGWPSGGGGYGA
  SVENAAAYMNNLVRHVGSGTPRRPGKAVETYIFAMFNENQKPEGVERYFGLFQPDMTEVYHVDF
Full Sequence
Protein Sequence     Length: 166     Download
MPVMAPLVSY LAERGSPLLV NAYPYFAYAA DPASVPLDYA LLSPSAAPAV TDDDGVQYVN    60
MFDAIVDAVH AAVEKVTGSG QGVELVVSET GWPSGGGGYG ASVENAAAYM NNLVRHVGSG    120
TPRRPGKAVE TYIFAMFNEN QKPEGVERYF GLFQPDMTEV YHVDF*                   180
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG5309COG53095.0e-68015683+
pfam00332Glyco_hydro_171.0e-602165165+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAA77786.102165149312beta-1,3-glucanase [Oryza sativa]
GenBankEAY98549.102165189352hypothetical protein OsI_20461 [Oryza sativa Indica Group]
RefSeqNP_001044540.101165174335Os01g0801500 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001055934.102165183346Os05g0495900 [Oryza sativa (japonica cultivar-group)]
Swiss-ProtQ0243901165155316E13F_HORVU RecName: Full=Putative glucan endo-1,3-beta-glucosidase GVI; AltName: Full=(1-
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2cyg_A04165155312A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3f55_D04165159315A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3f55_C04165159315A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3f55_B04165159315A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3f55_A04165159315A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CB68461016621650
CI18971616261650
EE17196116531650
CN14012916721650
FF36253017121650
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00709.1Aquca_052_00037.1Aquca_014_00710.1Aquca_014_00708.1Aquca_014_00706.1
Aquca_004_00503.1Aquca_023_00065.1Aquca_077_00005.1Aquca_049_00226.1Aquca_004_00503.2
Aquca_049_00225.1
Arabidopsis lyrata329886348799877890486168910094
486169881625488942910095910074
899139316691856124488959
Arabidopsis thalianaAT4G16260.1AT1G77780.1AT3G57240.1AT5G20330.1AT3G57270.1
AT5G20340.1AT5G20390.1AT3G57260.1AT1G33220.1AT5G20560.1
AT1G77790.1
Brachypodium distachyonBradi2g60490.1Bradi2g43056.1Bradi2g60441.1Bradi2g27140.1Bradi4g36190.1
Bradi2g21142.1Bradi2g60536.1Bradi2g60542.1Bradi1g15295.1Bradi2g22226.1
Bradi2g60557.1Bradi2g22224.1Bradi2g22222.1Bradi2g60497.1
Brassica rapaBra033549Bra007313Bra003273Bra007315Bra020110
Bra002311Bra002295Bra020100Bra014635Bra014638
Bra014636Bra015873Bra014640Bra008336Bra014637
Bra007314
Carica papayaevm.model.supercontig_69.53evm.model.supercontig_56.98evm.model.supercontig_49.125evm.model.supercontig_120.8evm.model.supercontig_120.1
evm.model.supercontig_120.2evm.model.supercontig_203.3evm.model.supercontig_49.124evm.model.supercontig_1107.1evm.model.supercontig_179.28
Capsella rubellaCarubv10005163mCarubv10020584mCarubv10017567mCarubv10018497mCarubv10003621m
Carubv10009618mCarubv10007632mCarubv10017587mCarubv10017580mCarubv10021473m
Carubv10003855m
Citrus clementinaCiclev10031945mCiclev10017983mCiclev10029843mCiclev10005195mCiclev10005181m
Ciclev10012099mCiclev10005316mCiclev10007126mCiclev10006922mCiclev10006479m
Ciclev10001717mCiclev10005324mCiclev10006634mCiclev10006696m
Citrus sinensisorange1.1g048613morange1.1g048190morange1.1g019260morange1.1g018955morange1.1g018966m
orange1.1g019014morange1.1g019755morange1.1g043874morange1.1g025491morange1.1g046047m
orange1.1g044365morange1.1g039749morange1.1g043422morange1.1g043818morange1.1g043597m
Cucumis sativusCucsa.167580.1Cucsa.333910.1Cucsa.356950.1Cucsa.274690.1Cucsa.333930.2
Cucsa.333930.1Cucsa.274680.1
Eucalyptus grandisEucgr.B03315.1Eucgr.L02807.1Eucgr.F03742.1
Fragaria vescamrna14817.1-v1.0-hybridmrna05145.1-v1.0-hybridmrna21959.1-v1.0-hybridmrna05671.1-v1.0-hybrid.230.538mrna05671.1-v1.0-hybrid.230.538
mrna12482.1-v1.0-hybridmrna14292.1-v1.0-hybridmrna14815.1-v1.0-hybridmrna17857.1-v1.0-hybrid
Glycine maxGlyma03g28870.1Glyma12g02410.1Glyma11g10080.1Glyma16g21710.1Glyma16g21740.2
Glyma11g10070.1Glyma16g21640.1Glyma09g04191.2Glyma09g04191.1Glyma06g11390.1
Glyma19g31580.1Glyma15g15200.1Glyma03g28850.1Glyma19g31590.2Glyma19g31590.1
Glyma09g04200.2Glyma11g10091.1Glyma16g21700.2Glyma15g15211.1
Gossypium raimondiiGorai.010G003600.1Gorai.010G003500.1Gorai.008G159300.1Gorai.009G074100.1Gorai.006G134700.1
Gorai.006G079600.1Gorai.009G242500.1Gorai.006G079400.1Gorai.004G257700.1Gorai.006G134600.1
Gorai.010G003700.1Gorai.008G159300.2.125.311Gorai.008G159300.2.125.311
Linum usitatissimumLus10029149Lus10013016Lus10039233Lus10014110Lus10016883
Lus10002807Lus10031037Lus10019801Lus10014108Lus10014109
Lus10027479Lus10010091Lus10027860Lus10035423Lus10019800
Lus10031035Lus10031033Lus10031036
Malus domesticaMDP0000256573MDP0000327191MDP0000918948MDP0000250870MDP0000576756
MDP0000298027MDP0000265527MDP0000570395MDP0000563788MDP0000796925
MDP0000834943MDP0000416440MDP0000880357MDP0000820007MDP0000282861.136.425
MDP0000282861.136.425MDP0000163547MDP0000127517MDP0000247130.244.451MDP0000247130.244.451
MDP0000521510
Manihot esculentacassava4.1_010983mcassava4.1_009799mcassava4.1_023576m
Medicago truncatulaMedtr4g076470.1Medtr2g034440.1Medtr4g076430.1Medtr4g076440.1Medtr2g034470.1
Medtr7g081370.1Medtr7g081350.1Medtr4g076570.1Medtr4g076490.1Medtr4g076500.1
Medtr2g034480.1Medtr4g076250.1
Mimulus guttatusmgv1a009451mmgv1a009099mmgv1a009184mmgv1a009606mmgv1a020557m
mgv1a009249mmgv1a009371mmgv1a026276m
Oryza sativaLOC_Os01g71340.1LOC_Os01g71400.1LOC_Os01g71860.1.324.630LOC_Os01g71860.1.324.630LOC_Os01g71930.1
LOC_Os01g71380.1LOC_Os01g51570.1LOC_Os01g71410.1LOC_Os09g36280.1LOC_Os01g58730.1
LOC_Os05g41610.1LOC_Os01g71830.1LOC_Os01g71810.1LOC_Os01g71820.1LOC_Os05g31140.1
LOC_Os01g71680.1LOC_Os01g71350.1LOC_Os05g31140.3LOC_Os05g31140.2LOC_Os01g71474.1
LOC_Os01g71670.1LOC_Os01g71690.3LOC_Os01g71690.2LOC_Os01g71650.1LOC_Os03g22530.1
LOC_Os03g56130.1LOC_Os07g41014.1
Panicum virgatumPavirv00070670mPavirv00014109mPavirv00036938mPavirv00057359mPavirv00029945m
Pavirv00002244mPavirv00000755mPavirv00069874mPavirv00015614mPavirv00007129m
Pavirv00070558mPavirv00053670mPavirv00025674mPavirv00022362mPavirv00016955m
Pavirv00026418mPavirv00033312mPavirv00058859m.81.297Pavirv00058859m.81.297Pavirv00052769m
Pavirv00052474mPavirv00000958mPavirv00064841mPavirv00000252mPavirv00057392m
Pavirv00015902mPavirv00070799mPavirv00070030m
Physcomitrella patensPp1s26_166V6.1
Phaseolus vulgarisPhvul.011G177000.1Phvul.011G077900.1Phvul.001G128500.1Phvul.009G256500.1Phvul.009G256400.2
Phvul.009G256400.1
Picea abiesMA_202096g0010MA_8691g0010.97.408MA_8691g0010.97.408MA_28098g0010MA_10266495g0010
MA_475809g0010MA_10432716g0010MA_10431609g0010MA_10432716g0030MA_10337257g0010
MA_8465203g0010MA_795943g0010MA_934111g0010
Populus trichocarpaPotri.001G255100.1Potri.016G057400.1Potri.006G048100.1Potri.016G057600.1Potri.005G172000.1
Potri.009G050300.1Potri.016G135900.1Potri.010G142800.1Potri.T167100.1Potri.010G142800.2
Potri.002G089200.1Potri.006G046100.1Potri.001G255100.2Potri.009G050400.2Potri.009G050400.1
Potri.010G088500.1
Prunus persicappa020503mppa024457mppa018225mppa007999mppa026579m
ppa025430mppa023845mppa1027220mppa017239mppa008126m
ppa015919mppa017802mppa024064mppa024759mppa020193m
Ricinus communis29676.m00166629908.m00619130169.m00647429631.m00102330053.m000106
30147.m013731.50.28430147.m013731.50.284
Setaria italicaSi002182mSi002306mSi028122mSi022625mSi002065m
Si022492mSi003802mSi000491mSi004560mSi005124m
Si022606mSi024558mSi022731mSi022614mSi002273m
Si022794mSi022791m
Selaginella moellendorffii233178
Sorghum bicolorSb03g045460.1Sb03g045450.1Sb08g019670.1Sb02g030930.1Sb09g024320.1
Sb03g037270.1Sb03g045630.1Sb09g018730.2Sb09g018730.1Sb03g045510.1
Sb09g025890.1Sb09g018730.4Sb09g018730.3Sb03g045490.1Sb09g018750.1
Sb03g045480.1Sb03g045520.1
Thellungiella halophilaThhalv10025628mThhalv10003127mThhalv10019644mThhalv10015407mThhalv10007971m
Thhalv10003126mThhalv10015636mThhalv10015248mThhalv10008546m
Vitis viniferaGSVIVT01013131001GSVIVT01033545001.34.314GSVIVT01033545001.34.314GSVIVT01033542001GSVIVT01033536001
GSVIVT01031542001.119.325GSVIVT01031542001.119.325GSVIVT01033538001GSVIVT01033545001.379.572GSVIVT01033545001.379.572
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)