y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi2g52740.1
FamilyGT1
Protein PropertiesLength: 469 Molecular Weight: 51050.4 Isoelectric Point: 6.565
ChromosomeChromosome/Scaffold: 2 Start: 52025484 End: 52027540
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT1184341.7e-34
  PGRGHINPMLAVCRQLVAAADGALAVTVVVTEEWRGLLASAPLPDRVRFATIPNVIPSEHGRGADHAGFIEAVHAKMAGALDRLLDRLELDLGRTPDAIL
  ADTYLTWGVAAGARKGIPVCSLWTQPATFFLALYHSDRWPPLDGRASEEELSIKSLEEYVPGLSSVRLSDIKIFRSWARPMEITEEVFAHARKAHCVLLT
  SFHELEPSAINRMAESLPCPVYPIGPSVPQHMPLEGSKIHEEEEHRSWLDAQPENSVLYVSFGSFVSMAPAQLEEIAMGIRDSGVRFFWVARDKAPDVRR
  MCGGGDKGGLAVLWCDQQKVLCHPSVGGFLSHCGWNSLLEAVRAGVPLLAFPVGWDQLVNARIVADEWKVGINLREQRREDGVVSRAAISAAAAKLMDLD
  RGASQEMRRRAGELRQA
Full Sequence
Protein Sequence     Length: 469     Download
MASMATATAR HVVAVPFPGR GHINPMLAVC RQLVAAADGA LAVTVVVTEE WRGLLASAPL    60
PDRVRFATIP NVIPSEHGRG ADHAGFIEAV HAKMAGALDR LLDRLELDLG RTPDAILADT    120
YLTWGVAAGA RKGIPVCSLW TQPATFFLAL YHSDRWPPLD GRASEEELSI KSLEEYVPGL    180
SSVRLSDIKI FRSWARPMEI TEEVFAHARK AHCVLLTSFH ELEPSAINRM AESLPCPVYP    240
IGPSVPQHMP LEGSKIHEEE EHRSWLDAQP ENSVLYVSFG SFVSMAPAQL EEIAMGIRDS    300
GVRFFWVARD KAPDVRRMCG GGDKGGLAVL WCDQQKVLCH PSVGGFLSHC GWNSLLEAVR    360
AGVPLLAFPV GWDQLVNARI VADEWKVGIN LREQRREDGV VSRAAISAAA AKLMDLDRGA    420
SQEMRRRAGE LRQASRSAVQ EGGSSHRSLS NFVQDLMEGR LGAAETSQ*                480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02173PLN021733.0e-4911453473+
PLN02210PLN022102.0e-5111456468+
PLN02410PLN024106.0e-5310454467+
PLN02555PLN025555.0e-6111462481+
PLN02448PLN0244801460468+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACN29171.101646814470unknown [Zea mays]
GenBankEEC71663.1054613464hypothetical protein OsI_04125 [Oryza sativa Indica Group]
RefSeqNP_001044560.1054613467Os01g0805400 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002441308.101145410456hypothetical protein SORBIDRAFT_09g024190 [Sorghum bicolor]
RefSeqXP_002456501.10264671440hypothetical protein SORBIDRAFT_03g037440 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2pq6_A01145710478A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vg8_A044501461A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vch_A044501461A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vce_A044501461A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2acw_B2e-401245612461A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
Metabolic Pathways
Pathway NameReactionECProtein Name
cytokinins-O-glucoside biosynthesisRXN-4723EC-2.4.1.203trans-zeatin O-β-D-glucosyltransferase
cytokinins-O-glucoside biosynthesisRXN-4726EC-2.4.1UDP-glucose:dihydrozeatin O-β-D-glucosyltransferase
cytokinins-O-glucoside biosynthesisRXN-4735EC-2.4.1.215cis-zeatin O-β-D-glucosyltransferase
cytokinins-O-glucoside biosynthesisRXN-4737EC-2.4.1dihydrozeatin-9-N-glucoside O-β-D-glucosyltransferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EG38106129112870
CJ8346412492074540
EG399308256342850
BQ80567924192450
EG3798442102594670
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_030_00224.2Aquca_030_00224.1Aquca_030_00223.1Aquca_030_00247.1
Arabidopsis lyrata481926481925
Arabidopsis thalianaAT2G30150.1AT2G30140.1AT2G30140.2
Brachypodium distachyonBradi2g21317.1Bradi2g52750.1
Brassica rapaBra018333Bra022781Bra018334
Carica papayaevm.model.supercontig_46.189evm.model.supercontig_2.368
Capsella rubellaCarubv10023179mCarubv10023176m
Citrus clementinaCiclev10028376mCiclev10028375mCiclev10028356mCiclev10029825m
Citrus sinensisorange1.1g012096morange1.1g044218m
Cucumis sativusCucsa.139460.1Cucsa.139470.1
Eucalyptus grandisEucgr.B00404.1Eucgr.B00406.1Eucgr.J01864.1Eucgr.J01863.1Eucgr.J01875.1
Eucgr.B03993.1Eucgr.B03996.1Eucgr.J01877.1Eucgr.J01867.1Eucgr.B03994.1
Eucgr.B03997.2Eucgr.B03997.1Eucgr.J01880.1Eucgr.J01869.1Eucgr.B00411.1
Eucgr.J01874.1Eucgr.J01870.1Eucgr.B00409.1Eucgr.J01868.1Eucgr.J01873.1
Fragaria vescamrna28195.1-v1.0-hybridmrna28196.1-v1.0-hybridmrna28194.1-v1.0-hybridmrna28201.1-v1.0-hybridmrna28199.1-v1.0-hybrid
mrna28200.1-v1.0-hybridmrna28193.1-v1.0-hybrid
Glycine maxGlyma02g39680.1Glyma02g39700.2Glyma14g37770.1Glyma14g37730.1Glyma04g36200.1
Glyma04g36200.2Glyma02g39700.1Glyma11g29480.2
Gossypium raimondiiGorai.013G271000.1Gorai.009G113100.1Gorai.009G113100.2Gorai.013G270900.1Gorai.013G271100.1
Linum usitatissimumLus10042260Lus10026394Lus10026393Lus10042261Lus10042262
Lus10042264
Malus domesticaMDP0000593031MDP0000376869MDP0000173539MDP0000222559MDP0000686301
MDP0000396630MDP0000396403MDP0000739392.384.594MDP0000739392.384.594MDP0000263453
MDP0000317841MDP0000276057MDP0000379060MDP0000902216MDP0000156246
MDP0000313145MDP0000166802MDP0000229763MDP0000811246
Manihot esculentacassava4.1_007402mcassava4.1_007201m
Medicago truncatulaMedtr5g072810.1Medtr5g072830.1Medtr5g072820.1Medtr5g072840.1Medtr5g072860.1
Medtr3g031400.1Medtr3g031450.1Medtr5g075440.1Medtr5g072850.1
Mimulus guttatusmgv1a005987mmgv1a021616m
Oryza sativaLOC_Os01g59110.1LOC_Os01g59100.1LOC_Os05g41400.1
Panicum virgatumPavirv00005550mPavirv00033216mPavirv00018377mPavirv00053061m
Phaseolus vulgarisPhvul.008G256800.2Phvul.008G256800.1Phvul.008G256600.1Phvul.008G256600.2Phvul.008G257200.1
Picea abiesMA_10434904g0010
Populus trichocarpaPotri.001G281900.1Potri.001G282100.1Potri.009G077400.1Potri.009G077200.1Potri.009G077500.1
Potri.001G281800.1
Prunus persicappa015751mppa022795mppa024989mppa006015mppa019639m
ppa026425mppa005406m
Ricinus communis27561.m00029029628.m000755
Setaria italicaSi004951mSi024733mSi024959mSi001326m
Selaginella moellendorffii439509
Sorghum bicolorSb03g037450.1Sb03g037440.1Sb09g024190.1
Thellungiella halophilaThhalv10025222mThhalv10016641m
Vitis viniferaGSVIVT01024653001GSVIVT01024655001GSVIVT01024656001GSVIVT01024649001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)