y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi2g52750.1
FamilyGT1
Protein PropertiesLength: 492 Molecular Weight: 53393.2 Isoelectric Point: 5.4197
ChromosomeChromosome/Scaffold: 2 Start: 52027934 End: 52030511
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT12744561.3e-37
  TLEDQHLKPNGEVTSSGDCFTWLDSQPVNSVLYVSLGSFLSVSASQLDEIALGLAASEVRFLWTLREQSPRVRELVGDTTRGMILPWCNQLKVLCHPSVG
  GFLTHCGMNSTLEAVFAGVPMLTLPLFFDQPIDSRLIVEEWKVGLELRDWTGKDHLIVSEEVARAVKRLMASDVADTEEIRRC
Full Sequence
Protein Sequence     Length: 492     Download
MAAAGDEPRR CHVVAVPFPG RGHVNAMMNL CRILAARGAT ATFVVTEEWL GLLSSSSASP    60
PPPGVRLRAI PNVIPSEHGR AADHGGFLDA VSTVMEAPFE RLLDQLLEEE GEKEGTPPVS    120
ALVADTYLPW VVGVGNRRGV PVCSLFPMAA TFFSAYHHFD CLPPCLADKH DPASGVTTDK    180
SDQRLEHYIS GMASSSVTLS DLKPLIHNER TVKHVIAAVS SIRDAHCLLF TTMYELEASV    240
IDSLTSVLPC PVFPIGPCVP YLTLEDQHSN PNLTLEDQHL KPNGEVTSSG DCFTWLDSQP    300
VNSVLYVSLG SFLSVSASQL DEIALGLAAS EVRFLWTLRE QSPRVRELVG DTTRGMILPW    360
CNQLKVLCHP SVGGFLTHCG MNSTLEAVFA GVPMLTLPLF FDQPIDSRLI VEEWKVGLEL    420
RDWTGKDHLI VSEEVARAVK RLMASDVADT EEIRRCALGL KEVSGRAVKK GGSSYRNLSS    480
LMEMLCSKTD P*                                                        540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02210PLN022101.0e-447482488+
PLN02534PLN025342.0e-4510483512+
PLN02410PLN024104.0e-496485499+
PLN02555PLN025553.0e-605485515+
PLN02448PLN0244801486490+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEAZ13874.10541511382hypothetical protein OsJ_03799 [Oryza sativa Japonica Group]
RefSeqNP_001044561.10548611479Os01g0805500 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001148167.101248714472indole-3-acetate beta-glucosyltransferase [Zea mays]
RefSeqXP_002441308.10114859458hypothetical protein SORBIDRAFT_09g024190 [Sorghum bicolor]
RefSeqXP_002456502.1014871472hypothetical protein SORBIDRAFT_03g037450 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2pq6_A094837475A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vg8_A064792461A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vch_A064792461A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vce_A064792461A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2acv_B3e-3964835459A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
Metabolic Pathways
Pathway NameReactionECProtein Name
sinapate ester biosynthesisSINAPATE-1-GLUCOSYLTRANSFERASE-RXNEC-2.4.1.120sinapate 1-glucosyltransferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GT8155172372124480
BQ7526922871214060
JG2975192442444870
CD9285642402144520
CK20868929012880
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_030_00224.2Aquca_030_00224.1Aquca_030_00223.1Aquca_030_00247.1
Arabidopsis lyrata481926481925
Arabidopsis thalianaAT2G30150.1AT2G30140.1AT2G30140.2
Brachypodium distachyonBradi2g21317.1Bradi2g52740.1
Brassica rapaBra018333Bra022781Bra018334
Carica papayaevm.model.supercontig_46.189evm.model.supercontig_2.368
Capsella rubellaCarubv10023179mCarubv10023176m
Citrus clementinaCiclev10028376mCiclev10028375mCiclev10028356mCiclev10029825m
Citrus sinensisorange1.1g012096morange1.1g044218m
Cucumis sativusCucsa.139460.1Cucsa.139470.1
Eucalyptus grandisEucgr.B00404.1Eucgr.B00406.1Eucgr.J01864.1Eucgr.J01863.1Eucgr.J01875.1
Eucgr.B03993.1Eucgr.B03996.1Eucgr.J01877.1Eucgr.J01867.1Eucgr.B03994.1
Eucgr.B03997.2Eucgr.B03997.1Eucgr.J01880.1Eucgr.J01869.1Eucgr.B00411.1
Eucgr.J01874.1Eucgr.J01870.1Eucgr.B00409.1Eucgr.J01868.1Eucgr.J01873.1
Fragaria vescamrna28195.1-v1.0-hybridmrna28196.1-v1.0-hybridmrna28194.1-v1.0-hybridmrna28201.1-v1.0-hybridmrna28199.1-v1.0-hybrid
mrna28200.1-v1.0-hybridmrna28193.1-v1.0-hybrid
Glycine maxGlyma02g39680.1Glyma02g39700.2Glyma14g37770.1Glyma14g37730.1Glyma04g36200.1
Glyma04g36200.2Glyma02g39700.1Glyma11g29480.2
Gossypium raimondiiGorai.013G271000.1Gorai.009G113100.1Gorai.009G113100.2Gorai.013G270900.1Gorai.013G271100.1
Linum usitatissimumLus10042260Lus10026394Lus10026393Lus10042261Lus10042262
Lus10042264
Malus domesticaMDP0000593031MDP0000376869MDP0000173539MDP0000222559MDP0000686301
MDP0000396630MDP0000396403MDP0000739392.384.594MDP0000739392.384.594MDP0000263453
MDP0000317841MDP0000276057MDP0000379060MDP0000902216MDP0000156246
MDP0000313145MDP0000166802MDP0000229763MDP0000811246
Manihot esculentacassava4.1_007402mcassava4.1_007201m
Medicago truncatulaMedtr5g072810.1Medtr5g072830.1Medtr5g072820.1Medtr5g072840.1Medtr5g072860.1
Medtr3g031400.1Medtr3g031450.1Medtr5g075440.1Medtr5g072850.1
Mimulus guttatusmgv1a005987mmgv1a021616m
Oryza sativaLOC_Os01g59110.1LOC_Os01g59100.1LOC_Os05g41400.1
Panicum virgatumPavirv00005550mPavirv00033216mPavirv00018377mPavirv00053061m
Phaseolus vulgarisPhvul.008G256800.2Phvul.008G256800.1Phvul.008G256600.1Phvul.008G256600.2Phvul.008G257200.1
Picea abiesMA_10434904g0010
Populus trichocarpaPotri.001G281900.1Potri.001G282100.1Potri.009G077400.1Potri.009G077200.1Potri.009G077500.1
Potri.001G281800.1
Prunus persicappa015751mppa022795mppa024989mppa006015mppa019639m
ppa026425mppa005406m
Ricinus communis27561.m00029029628.m000755
Setaria italicaSi004951mSi024733mSi024959mSi001326m
Selaginella moellendorffii439509
Sorghum bicolorSb03g037450.1Sb03g037440.1Sb09g024190.1
Thellungiella halophilaThhalv10025222mThhalv10016641m
Vitis viniferaGSVIVT01024653001GSVIVT01024655001GSVIVT01024656001GSVIVT01024649001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)