y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi2g54350.1
FamilyPL1
Protein PropertiesLength: 397 Molecular Weight: 43523.6 Isoelectric Point: 5.1493
ChromosomeChromosome/Scaffold: 2 Start: 53311902 End: 53313386
DescriptionPectin lyase-like superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
PL11162950
  IVFDVSGTIHLSSGLRVSSYKTIDGRGQRVTLSGKGLLLRECEHVILCNLEVEGGRGHDADAVQIKPRSRHVWVDRCGLRDFADGLLDVTCGSTDVTVSR
  CRFSAHDKAVLIGASSGHVQDRGIRVTIHHCFFDGTRQRQPRVRFGRVHLYNNYTRGWGIYAVCASVESQIVSQHNIYEA
Full Sequence
Protein Sequence     Length: 397     Download
MAPPQSDEQL GAEPAMEGLT IPPDQNDEPT MDGYTVPPHD HSVDQLIGNL PPMQDTTFIP    60
YAAVDSSLRA MAGQAEGFGR HAIGGLHGDV YHVTTLADDG PGSLRVGCRR QEPLWIVFDV    120
SGTIHLSSGL RVSSYKTIDG RGQRVTLSGK GLLLRECEHV ILCNLEVEGG RGHDADAVQI    180
KPRSRHVWVD RCGLRDFADG LLDVTCGSTD VTVSRCRFSA HDKAVLIGAS SGHVQDRGIR    240
VTIHHCFFDG TRQRQPRVRF GRVHLYNNYT RGWGIYAVCA SVESQIVSQH NIYEAGEKKK    300
AFMYMNEQAA DRDKSSSGSI RSEGDLFLNG AEDCNENDSE ENLWDFEVKN CYQSCSAQPA    360
SLALKELLEY CTGWQPVPLP EDIRFAENCA AATTDI*                             420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00544Pec_lyase_C2.0e-36117291195+
COG3866PelB4.0e-4184330266+
smart00656Amb_all8.0e-61119296190+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAD73403.10373953340putative pectate lyase [Oryza sativa Japonica Group]
EMBLCBI32661.10593824324unnamed protein product [Vitis vinifera]
GenBankEAY76417.10963951305hypothetical protein OsI_04348 [Oryza sativa Indica Group]
RefSeqXP_002277576.105938248368PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002456600.10443877356hypothetical protein SORBIDRAFT_03g039150 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1pxz_B4.99983e-426535015331A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB1pxz_A4.99983e-426535015331A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB1vbl_A1e-23130293128330A Chain A, Structure Of The Thermostable Pectate Lyase Pl 47
PDB3zsc_A9e-228329322246A Chain A, Catalytic Function And Substrate Recognition Of The Pectate Lyase From Thermotoga Maritima
PDB1pcl_A3e-1912827274248A Chain A, Unusual Structural Features In The Parallel Beta-Helix In Pectate Lyases
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DY289690309233310
DY271752304233260
DY275282334593860
JG177860305763800
EL513630281523320
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_027_00219.1.467.641Aquca_027_00219.1.467.641Aquca_027_00219.1.123.302Aquca_027_00219.1.123.302Aquca_027_00219.2.123.302
Aquca_027_00219.2.123.302Aquca_027_00219.3Aquca_027_00219.2.467.633Aquca_027_00219.2.467.633
Arabidopsis lyrata485935478272
Arabidopsis thalianaAT3G55140.1AT3G55140.2AT3G09540.1
Brachypodium distachyonBradi1g22147.1
Brassica rapaBra029773Bra014772
Capsella rubellaCarubv10014016mCarubv10017857mCarubv10017611m
Citrus clementinaCiclev10012162mCiclev10032073mCiclev10032345mCiclev10012161mCiclev10011951m
Citrus sinensisorange1.1g016742morange1.1g016766morange1.1g017111morange1.1g017716morange1.1g020048m
orange1.1g020121morange1.1g022635morange1.1g023514morange1.1g024841m
Cucumis sativusCucsa.065830.2Cucsa.065830.1
Eucalyptus grandisEucgr.J01160.1Eucgr.A01218.1Eucgr.A01218.2Eucgr.J01160.2
Fragaria vescamrna18180.1-v1.0-hybridmrna23375.1-v1.0-hybrid
Glycine maxGlyma20g38490.1Glyma10g05290.2Glyma13g19670.2
Gossypium raimondiiGorai.011G245200.2Gorai.011G245200.1Gorai.006G176400.1
Linum usitatissimumLus10030313Lus10003307Lus10025290Lus10024439
Malus domesticaMDP0000302815MDP0000319235MDP0000259620MDP0000215346MDP0000196711
MDP0000322627
Manihot esculentacassava4.1_010014mcassava4.1_030620m
Mimulus guttatusmgv1a009885mmgv1a008720m
Oryza sativaLOC_Os01g62000.1LOC_Os01g36620.1
Panicum virgatumPavirv00008711mPavirv00047085mPavirv00064103m
Physcomitrella patensPp1s37_38V6.3Pp1s37_38V6.4Pp1s37_38V6.2Pp1s37_38V6.1
Phaseolus vulgarisPhvul.007G009300.1Phvul.007G160100.1
Picea abiesMA_10426401g0010
Populus trichocarpaPotri.006G214400.1Potri.016G080600.1Potri.008G048600.1
Prunus persicappa008409mppa007270m
Ricinus communis29690.m00040929469.m000051
Setaria italicaSi004466mSi010447m
Selaginella moellendorffii93746412910
Sorghum bicolorSb03g039150.1Sb08g004905.1
Thellungiella halophilaThhalv10020972mThhalv10010534m
Vitis viniferaGSVIVT01025593001GSVIVT01005974001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)