y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi2g55060.1
FamilyAA1
Protein PropertiesLength: 555 Molecular Weight: 60278.4 Isoelectric Point: 4.8446
ChromosomeChromosome/Scaffold: 2 Start: 53803823 End: 53806193
Descriptionlaccase 7
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA1215400
  AAIVEHTFNVGGMNISQLCTDTVIYTANEQLPGPTIEATEGDTVVVHVVNDSPYPLSIHWHGIFQLLSGWADGAHMITDCSVQPSGNFTYQFNVTAQEGT
  LWWHAHSSLLRATIYGALIIKPRNGTDGYPFPAPYGEIPILLGEWWNKNVNDVEIDAHLTGLGQDISDALTLNGLPGDQTPCTGAGIYGVEVEYNKTYLL
  RIINAAVNVELFFKVAGHNFTVVAIDASYTDPYATDTIVITPGQTVDALMTTSAPPGRYYMAANVFDSKTVPFRFNTGTATGIVKYEDAPDDDATATMPT
  MPSHEDVVTAGNFYWSLTGLVRPSDPPVPKTVDHDMVVEFGVDQAPCAVEQTKCQGFALVAFMNRNSFQFPRNASLLKALYDGVQGRVYSEDFPSSPPPL
  PGIRRATSVKRLNYGDVVEVVLQSRVYSSVLGAENHPIHLHGFNFFVLAQGLGRFDPRANSTYNLVNPQVRNTVAVPAGGWAVIRFTANNPGMWFMHCHL
  DAHLPLGLAMVFEVLDGPAP
Full Sequence
Protein Sequence     Length: 555     Download
MERAAMIVPL VLALCTAMAS AAIVEHTFNV GGMNISQLCT DTVIYTANEQ LPGPTIEATE    60
GDTVVVHVVN DSPYPLSIHW HGIFQLLSGW ADGAHMITDC SVQPSGNFTY QFNVTAQEGT    120
LWWHAHSSLL RATIYGALII KPRNGTDGYP FPAPYGEIPI LLGEWWNKNV NDVEIDAHLT    180
GLGQDISDAL TLNGLPGDQT PCTGAGIYGV EVEYNKTYLL RIINAAVNVE LFFKVAGHNF    240
TVVAIDASYT DPYATDTIVI TPGQTVDALM TTSAPPGRYY MAANVFDSKT VPFRFNTGTA    300
TGIVKYEDAP DDDATATMPT MPSHEDVVTA GNFYWSLTGL VRPSDPPVPK TVDHDMVVEF    360
GVDQAPCAVE QTKCQGFALV AFMNRNSFQF PRNASLLKAL YDGVQGRVYS EDFPSSPPPL    420
PGIRRATSVK RLNYGDVVEV VLQSRVYSSV LGAENHPIHL HGFNFFVLAQ GLGRFDPRAN    480
STYNLVNPQV RNTVAVPAGG WAVIRFTANN PGMWFMHCHL DAHLPLGLAM VFEVLDGPAP    540
NLLPPPPVDY PKCY*                                                     600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02835PLN028352.0e-445516537+
PLN02604PLN026042.0e-591533569+
PLN02191PLN021913.0e-6910532562+
TIGR03388ascorbase2.0e-8023533545+
TIGR03389laccase021553550+
Gene Ontology
GO TermDescription
GO:0005507copper ion binding
GO:0016491oxidoreductase activity
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAD82649.102551325512putative laccase LAC6-8 [Oryza sativa Japonica Group]
GenBankEEC71812.102555425553hypothetical protein OsI_04450 [Oryza sativa Indica Group]
RefSeqNP_001044816.102551225511Os01g0850800 [Oryza sativa (japonica cultivar-group)]
Swiss-ProtQ0JHP802555425553LAC8_ORYSJ RecName: Full=Laccase-8; AltName: Full=Benzenediol:oxygen oxidoreductase 8; AltName: Full=Urishiol oxidase 8; AltName: Full=Diphenol oxidase 8; Flags: Precursor
RefSeqXP_002456641.101855421557hypothetical protein SORBIDRAFT_03g039980 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1asq_B0215321521A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB1asq_A0215321521A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB1asp_B0215321521A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB1asp_A0215321521A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB1aso_B0215321521A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
Transmembrane Domains
StartEnd
724
Signal Peptide
Cleavage Site
21
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HX146138242232640
CK19861521812180
HO797675495765530
HX1461662143425550
CX607272215182320
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00804.1Aquca_009_00807.1Aquca_009_00807.2
Arabidopsis lyrata478237472269486975
Arabidopsis thalianaAT3G09220.1AT5G01040.1AT5G01050.1
Brachypodium distachyonBradi4g39330.1Bradi2g55050.1Bradi4g11827.1Bradi4g11850.1Bradi3g45190.1
Bradi1g10567.1Bradi3g22317.1Bradi4g11780.1Bradi4g11770.1Bradi4g11840.1
Bradi3g02290.1Bradi3g02300.1
Brassica rapaBra029753Bra028885Bra005699
Capsella rubellaCarubv10016347mCarubv10000548m
Glycine maxGlyma01g26750.1Glyma03g15800.5Glyma03g15805.1Glyma01g26750.2Glyma07g17170.1
Glyma18g41886.1Glyma18g41860.1Glyma07g17150.1Glyma18g41870.1
Malus domesticaMDP0000291183
Manihot esculentacassava4.1_006971m
Oryza sativaLOC_Os01g63200.1LOC_Os01g63190.1LOC_Os11g42200.1LOC_Os11g42220.1LOC_Os11g16260.1
LOC_Os10g20610.1
Panicum virgatumPavirv00040765mPavirv00049024mPavirv00038281mPavirv00007769mPavirv00063349m
Pavirv00062920mPavirv00053056mPavirv00047982mPavirv00069158mPavirv00051794m
Pavirv00019186mPavirv00057102mPavirv00039741mPavirv00033330mPavirv00023383m
Pavirv00050058mPavirv00043455mPavirv00033589mPavirv00032842mPavirv00018047m
Pavirv00032841mPavirv00054602mPavirv00028624mPavirv00051105mPavirv00056353m
Pavirv00054858mPavirv00054859m
Phaseolus vulgarisPhvul.010G005900.1Phvul.008G112100.1
Setaria italicaSi021601mSi020688mSi027309mSi021573mSi021628m
Si004353mSi000613mSi026121mSi028303mSi027928m
Si009653mSi026113mSi028115mSi027394mSi026118m
Si026123mSi026150mSi026109mSi028248mSi027660m
Si026140mSi027267mSi026136mSi027586mSi026159m
Si026153mSi026117mSi028198mSi026161mSi026162m
Si008101mSi026299mSi026376mSi026137mSi024846m
Si001570mSi001277mSi001174mSi027990m.20.264Si027990m.20.264
Si027990m.273.533Si027990m.273.533
Sorghum bicolorSb08g011530.1Sb03g039960.1Sb03g039980.1Sb03g039970.1Sb05g026630.1
Sb03g009410.1Sb05g025570.1Sb02g000300.1
Thellungiella halophilaThhalv10020392mThhalv10020388mThhalv10013097mThhalv10013058mThhalv10015329m
Zea maysAC234190.1_FGT002
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)