y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi2g55120.1
FamilyGT35
Protein PropertiesLength: 834 Molecular Weight: 93856.9 Isoelectric Point: 7.4695
ChromosomeChromosome/Scaffold: 2 Start: 53826480 End: 53833267
Descriptionalpha-glucan phosphorylase 2
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT351058270
  ALKKFGYELEAIAGQERDAALGNGGLGRLASCFLDSMATLNLPAWGYGLRYRYGLFKQIIAKEGQEEFAEDWLDKFSPWEIVRHDVVYPIRFFGHVEISP
  DGTRKWAGGEVMSALAYDVPIPGYKTKNAISLRLWDAKATAQDFNLFQFNDGQYESAAQLHSRAQQICAVLYPGDATEEGKLLRLKQQYFLCSASLQDII
  FRFKERKPDRVSGKWSEFPSKVAVQMNDTHPTLAIPELMRLLMDEEGLGWDEAWDVTNKTVAYTNHTVLPEALEKWSQTVMRKLLPRHMEIIEEIDKRFR
  EMVISTRKDMEGKIESMRVLDNSNPEKPVVRMANLCVVSSHTVNGVAELHSNILKEELFADYVSIWPKKFQNKTNGITPRRWLRFCNPELSEIVTKWLKT
  DQWTSNLDLLIGLRKFADDEKLHAEWAAAKLASKKRLAKHVLDVTGVTIDPNSLFDIQIKRIHEYKRQLLNILGAVYRYKKLKEMSAEEKQKVTPRTVMV
  GGKAFATYTNAKRIVKLVNDVGAVVNNDPDVNKYLKVVFIPNYNVSVAEVLIPGSELSQHISTAGMEASGTSNMKFSLNGCLIIGTLDGANVEIREEVGQ
  DNFFLFGAKADQIAGLRKDRENGLFKPDPRFEEAKQLVRSGAFGSYDYTPLLDSLEGNSGFGRGDYFLVGYDFPSYIEAQARVDEAYKDKKRWIKMSILN
  TAGSGKFSSDRTIDQYAKEIWGI
Full Sequence
Protein Sequence     Length: 834     Download
MSAADKVKPA ATPGSADPAA IAGNISYHAQ YSPHFSPFAF GPEQAFFSTA ESVRDHLLQR    60
WNDTYVHFHK TDPKQTYYLS MEYLQGRALS NAVGSLGITG AYAEALKKFG YELEAIAGQE    120
RDAALGNGGL GRLASCFLDS MATLNLPAWG YGLRYRYGLF KQIIAKEGQE EFAEDWLDKF    180
SPWEIVRHDV VYPIRFFGHV EISPDGTRKW AGGEVMSALA YDVPIPGYKT KNAISLRLWD    240
AKATAQDFNL FQFNDGQYES AAQLHSRAQQ ICAVLYPGDA TEEGKLLRLK QQYFLCSASL    300
QDIIFRFKER KPDRVSGKWS EFPSKVAVQM NDTHPTLAIP ELMRLLMDEE GLGWDEAWDV    360
TNKTVAYTNH TVLPEALEKW SQTVMRKLLP RHMEIIEEID KRFREMVIST RKDMEGKIES    420
MRVLDNSNPE KPVVRMANLC VVSSHTVNGV AELHSNILKE ELFADYVSIW PKKFQNKTNG    480
ITPRRWLRFC NPELSEIVTK WLKTDQWTSN LDLLIGLRKF ADDEKLHAEW AAAKLASKKR    540
LAKHVLDVTG VTIDPNSLFD IQIKRIHEYK RQLLNILGAV YRYKKLKEMS AEEKQKVTPR    600
TVMVGGKAFA TYTNAKRIVK LVNDVGAVVN NDPDVNKYLK VVFIPNYNVS VAEVLIPGSE    660
LSQHISTAGM EASGTSNMKF SLNGCLIIGT LDGANVEIRE EVGQDNFFLF GAKADQIAGL    720
RKDRENGLFK PDPRFEEAKQ LVRSGAFGSY DYTPLLDSLE GNSGFGRGDY FLVGYDFPSY    780
IEAQARVDEA YKDKKRWIKM SILNTAGSGK FSSDRTIDQY AKEIWGITAS PVP*          840
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd04300GT1_Glycogen_Phosphorylase024827812+
TIGR02093P_ylase025827811+
pfam00343Phosphorylase0105827728+
COG0058GlgP017827815+
PRK14985PRK14985078825757+
Gene Ontology
GO TermDescription
GO:0004645phosphorylase activity
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAG45939.10258321808alpha 1,4-glucan phosphorylase H isozyme [Oryza sativa]
GenBankEEC71819.10383211840hypothetical protein OsI_04460 [Oryza sativa Indica Group]
RefSeqNP_001044823.10383211840Os01g0851700 [Oryza sativa (japonica cultivar-group)]
Swiss-ProtQ9LKJ3018331832PHSH_WHEAT RecName: Full=Alpha-glucan phosphorylase, H isozyme; AltName: Full=Starch phosphorylase H
RefSeqXP_002458773.1038328837hypothetical protein SORBIDRAFT_03g040060 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1z8d_A01483021831A Chain A, Crystal Structure Of Human Muscle Glycogen Phosphorylase A With Amp And Glucose
PDB4el5_A0148309819A Chain A, Crystal Structure Of Human Muscle Glycogen Phosphorylase A With Amp And Glucose
PDB4el0_A0148309819A Chain A, Crystal Structure Of Human Muscle Glycogen Phosphorylase A With Amp And Glucose
PDB4eky_A0148309819A Chain A, Crystal Structure Of Human Muscle Glycogen Phosphorylase A With Amp And Glucose
PDB4eke_A0148309819A Chain A, Crystal Structure Of Human Muscle Glycogen Phosphorylase A With Amp And Glucose
Metabolic Pathways
Pathway NameReactionECProtein Name
starch degradation IRXN-1826EC-2.4.1.1phosphorylase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7822004131615730
HO4180365392317490
GT0448383384678040
GT0434613304527810
GO8711183291354630
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00755.3Aquca_009_00755.2Aquca_009_00755.1Aquca_002_00786.1Aquca_002_00786.2
Arabidopsis lyrata485074323006
Arabidopsis thalianaAT3G46970.1AT3G29320.1
Brachypodium distachyonBradi1g08070.1.569.972Bradi1g08070.1.569.972Bradi1g08070.1.163.525Bradi1g08070.1.163.525
Brassica rapaBra018180Bra025392Bra033098
Carica papayaevm.model.supercontig_27.5evm.model.supercontig_112.64.358.739evm.model.supercontig_112.64.358.739evm.model.supercontig_14.158evm.model.supercontig_112.64.117.357
evm.model.supercontig_112.64.117.357
Capsella rubellaCarubv10019408mCarubv10016634m
Chlamydomonas reinhardtiiCre12.g552200.t1.2Cre07.g336950.t1.1
Citrus clementinaCiclev10027815mCiclev10027813mCiclev10010975m.585.995Ciclev10010975m.585.995Ciclev10010975m.176.514
Ciclev10010975m.176.514
Citrus sinensisorange1.1g004485morange1.1g003202morange1.1g003197morange1.1g003196morange1.1g003188m
orange1.1g003186morange1.1g005595morange1.1g003693morange1.1g003742morange1.1g004697m
orange1.1g004696morange1.1g007597morange1.1g003875m.374.784orange1.1g003875m.374.784orange1.1g003079m.434.844
orange1.1g003079m.434.844orange1.1g003074m.434.844orange1.1g003074m.434.844orange1.1g003072m.434.844orange1.1g003072m.434.844
orange1.1g003055m.436.846orange1.1g003055m.436.846orange1.1g001879m.585.995orange1.1g001879m.585.995orange1.1g009651m
orange1.1g002111morange1.1g012447morange1.1g005402m.400.692orange1.1g005402m.400.692orange1.1g005402m.25.349
orange1.1g005402m.25.349orange1.1g003079m.25.349orange1.1g003079m.25.349orange1.1g003074m.25.349orange1.1g003074m.25.349
orange1.1g003072m.25.349orange1.1g003072m.25.349orange1.1g001879m.176.500orange1.1g001879m.176.500orange1.1g003055m.25.351
orange1.1g003055m.25.351orange1.1g026345m
Cucumis sativusCucsa.126920.10Cucsa.126920.1Cucsa.139040.4Cucsa.139040.3Cucsa.139040.2
Cucsa.139040.1Cucsa.284600.1Cucsa.273090.1
Eucalyptus grandisEucgr.B02278.2Eucgr.B02278.1Eucgr.B03166.3Eucgr.B03166.2Eucgr.J01374.1
Eucgr.B03166.1Eucgr.B03166.5Eucgr.B03166.4
Fragaria vescamrna29749.1-v1.0-hybridmrna07968.1-v1.0-hybridmrna04322.1-v1.0-hybrid.157.481mrna04322.1-v1.0-hybrid.157.481
Glycine maxGlyma13g30920.2Glyma13g30920.3Glyma08g45210.1Glyma18g07480.1Glyma20g03250.4.554.965
Glyma20g03250.4.554.965Glyma20g03250.3.562.973Glyma20g03250.3.562.973Glyma20g03250.2.562.973Glyma20g03250.2.562.973
Glyma13g06040.1Glyma19g03490.1Glyma20g03250.4.161.485Glyma20g03250.4.161.485Glyma20g03250.3.169.493
Glyma20g03250.3.169.493Glyma20g03250.2.169.493Glyma20g03250.2.169.493
Gossypium raimondiiGorai.009G166800.1Gorai.013G260900.2Gorai.013G260900.1Gorai.013G260900.3Gorai.006G011500.7.330.728
Gorai.006G011500.7.330.728Gorai.006G011500.4.514.912Gorai.006G011500.4.514.912Gorai.006G011500.3.580.978Gorai.006G011500.3.580.978
Gorai.006G011500.2.583.981Gorai.006G011500.2.583.981Gorai.006G011500.1.583.986Gorai.006G011500.1.583.986Gorai.013G092200.1
Gorai.013G092200.2Gorai.006G011500.6.177.501Gorai.006G011500.6.177.501Gorai.006G011500.5.180.504Gorai.006G011500.5.180.504
Gorai.006G011500.4.111.435Gorai.006G011500.4.111.435Gorai.006G011500.3.177.501Gorai.006G011500.3.177.501Gorai.006G011500.2.180.504
Gorai.006G011500.2.180.504Gorai.006G011500.1.180.504Gorai.006G011500.1.180.504Gorai.006G011500.6.580.815Gorai.006G011500.6.580.815
Gorai.006G011500.5.583.818Gorai.006G011500.5.583.818
Linum usitatissimumLus10036892Lus10042688Lus10037093Lus10029643Lus10029644
Malus domesticaMDP0000288190MDP0000123354MDP0000266061MDP0000129346.602.999MDP0000129346.602.999
MDP0000145828MDP0000128518MDP0000778598MDP0000259799MDP0000129346.170.509
MDP0000129346.170.509MDP0000211642
Manihot esculentacassava4.1_001626mcassava4.1_002082mcassava4.1_024481mcassava4.1_002466mcassava4.1_002614m.310.707
cassava4.1_002614m.310.707cassava4.1_001096mcassava4.1_025456mcassava4.1_007176mcassava4.1_004717m.211.560
cassava4.1_004717m.211.560cassava4.1_002614m.25.217cassava4.1_002614m.25.217cassava4.1_004717m.25.195cassava4.1_004717m.25.195
cassava4.1_009211m
Medicago truncatulaMedtr2g014460.1Medtr6g014480.1Medtr4g082950.1.578.876Medtr4g082950.1.578.876Medtr4g082950.1.170.494
Medtr4g082950.1.170.494Medtr6g014480.2
Mimulus guttatusmgv1a000698mmgv1a001277mmgv1a000878mmgv1a002586mmgv1a002585m
Oryza sativaLOC_Os01g63270.1LOC_Os01g63270.2LOC_Os03g55090.1
Panicum virgatumPavirv00009874mPavirv00050649mPavirv00050650mPavirv00004990m.515.914Pavirv00004990m.515.914
Pavirv00034922m.529.918Pavirv00034922m.529.918Pavirv00034922m.119.465Pavirv00034922m.119.465Pavirv00004990m.97.438
Pavirv00004990m.97.438
Physcomitrella patensPp1s30_182V6.1Pp1s180_124V6.1Pp1s86_213V6.1Pp1s195_41V6.1Pp1s53_212V6.1.566.981
Pp1s53_212V6.1.566.981Pp1s53_212V6.1.179.499Pp1s53_212V6.1.179.499
Phaseolus vulgarisPhvul.006G182300.1Phvul.006G064100.1Phvul.002G168400.1.570.971Phvul.002G168400.1.570.971Phvul.004G034400.1.582.980
Phvul.004G034400.1.582.980Phvul.002G168400.1.169.519Phvul.002G168400.1.169.519Phvul.004G034400.1.180.504Phvul.004G034400.1.180.504
Picea abiesMA_10437129g0010MA_14581g0010MA_10428980g0010
Populus trichocarpaPotri.004G048600.1Potri.004G048600.2Potri.009G041800.1Potri.009G041800.3Potri.010G160200.2
Potri.009G041800.4Potri.009G041800.2.126.655Potri.009G041800.2.126.655Potri.004G123600.5Potri.010G160200.5
Potri.010G160200.1Potri.010G160200.7Potri.010G160200.4Potri.010G160200.3Potri.004G123600.4.176.534
Potri.004G123600.4.176.534Potri.004G123600.3.176.534Potri.004G123600.3.176.534Potri.004G123600.2.176.534Potri.004G123600.2.176.534
Potri.004G123600.1.176.533Potri.004G123600.1.176.533Potri.010G160200.6Potri.009G041800.2.660.825Potri.009G041800.2.660.825
Prunus persicappa000587mppa001354mppa000958mppa000827m.586.983ppa000827m.586.983
ppa000827m.171.506ppa000827m.171.506
Ricinus communis29751.m00179630190.m011310.461.94330190.m011310.461.94330174.m00913629630.m000793
30190.m011310.264.44430190.m011310.264.444
Setaria italicaSi000306mSi034019m
Selaginella moellendorffii148158164611184206
Sorghum bicolorSb03g040060.1Sb01g007560.2.550.949Sb01g007560.2.550.949Sb01g007560.1.580.979Sb01g007560.1.580.979
Sb01g007560.2.140.492Sb01g007560.2.140.492Sb01g007560.1.170.522Sb01g007560.1.170.522
Thellungiella halophilaThhalv10010122mThhalv10003599m
Vitis viniferaGSVIVT01021111001GSVIVT01024804001GSVIVT01012194001GSVIVT01011504001.577.977GSVIVT01011504001.577.977
GSVIVT01011504001.177.501GSVIVT01011504001.177.501
Volvox carteriVocar20006426mVocar20001423m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)