y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi2g55380.1
FamilyCBM20
Protein PropertiesLength: 344 Molecular Weight: 36931.8 Isoelectric Point: 6.2634
ChromosomeChromosome/Scaffold: 2 Start: 54039001 End: 54040921
DescriptionCarbohydrate-binding-like fold
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM20951806.9e-26
  VQVKFVLQKQCAFGQQFIVVGDDPALGLWDPTKATVLDWSEGHVWTAKKDLPASKSIEFKFLLRDPSGQVCWQHGCNRTLQITETS
Full Sequence
Protein Sequence     Length: 344     Download
MEAAAAVAWR GGALARARRP GARTRLHGVG AGAGPGTRRR FPVAVSSLGE RPSAPSRNAA    60
VMVALEIALV DEGVASTAVL PPPPDVSSPD PVKTVQVKFV LQKQCAFGQQ FIVVGDDPAL    120
GLWDPTKATV LDWSEGHVWT AKKDLPASKS IEFKFLLRDP SGQVCWQHGC NRTLQITETS    180
NVLVVHEDWD DAECQKLSEE VDVSIGADVI FAGSDDPLLD ENQEHSNGVM TVVSTDSEKT    240
SAVVIDASLL PRERMWVNGA NQSQSTLDQK VPEVLRRRAN MVAQNGNPAA AAGDHDGRII    300
LYEEGAPAGN RLAGMFENDI VWIRKALQRL LRSVGLRIGT RKT*                     360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
smart01065CBM_23.0e-139517888+
cd02853E_set_MTHase_like_N1.0e-159518995+
cd02861E_set_pullulanase_like6.0e-169619198+
pfam00686CBM_202.0e-199418595+
cd05467CBM202.0e-279618997+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0005975carbohydrate metabolic process
GO:2001070starch binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEAY76546.1013431387hypothetical protein OsI_04489 [Oryza sativa Indica Group]
GenBankEAZ14199.1013431387hypothetical protein OsJ_04123 [Oryza sativa Japonica Group]
RefSeqNP_001044849.1013431379Os01g0856900 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001152198.1053434348starch binding domain containing protein [Zea mays]
RefSeqXP_002456661.10534312373hypothetical protein SORBIDRAFT_03g040350 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1uks_B0.000000119189510684A Chain A, Crystal Structure Of F183lF259L MUTANT CYCLODEXTRIN Glucanotransferase Complexed With A Pseudo-Maltotetraose Derived From Acarbose
PDB1uks_A0.000000119189510684A Chain A, Crystal Structure Of F183lF259L MUTANT CYCLODEXTRIN Glucanotransferase Complexed With A Pseudo-Maltotetraose Derived From Acarbose
PDB1v3m_B0.000000119189510684A Chain A, Crystal Structure Of F183lF259L MUTANT CYCLODEXTRIN Glucanotransferase Complexed With A Pseudo-Maltotetraose Derived From Acarbose
PDB1v3m_A0.000000119189510684A Chain A, Crystal Structure Of F183lF259L MUTANT CYCLODEXTRIN Glucanotransferase Complexed With A Pseudo-Maltotetraose Derived From Acarbose
PDB1v3l_B0.000000119189510684A Chain A, Crystal Structure Of F183lF259L MUTANT CYCLODEXTRIN Glucanotransferase Complexed With A Pseudo-Maltotetraose Derived From Acarbose
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DV474934195262200
DV4789451211442640
DV478945812643440
GT8473941062393440
GT8473931062393440
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_045_00042.3Aquca_045_00042.2Aquca_045_00042.1Aquca_009_00054.3.18.103
Arabidopsis lyrata486949489476
Arabidopsis thalianaAT5G01260.2AT5G01260.1AT5G26570.2AT5G26570.1
Brachypodium distachyonBradi2g55380.3Bradi2g55380.2
Brassica rapaBra005693
Carica papayaevm.model.supercontig_112.34evm.model.supercontig_163.14
Capsella rubellaCarubv10001501mCarubv10001111mCarubv10000070m
Chlamydomonas reinhardtiiCre17.g719900.t1.2Cre17.g703000.t1.3Cre06.g269650.t1.2Cre12.g551200.t1.2g10103.t1
Cre02.g091750.t2.1Cre02.g091750.t1.2Cre02.g091750.t3.1Cre12.g492750.t1.3.499.578Cre12.g492750.t1.3.499.578
Cre09.g415600.t2.1Cre09.g415600.t1.3Cre12.g492750.t1.3.218.305Cre12.g492750.t1.3.218.305Cre10.g450500.t1.2
Citrus clementinaCiclev10011625mCiclev10011624mCiclev10011524mCiclev10011409mCiclev10005295m
Ciclev10005277mCiclev10004968mCiclev10010989m.24.109
Citrus sinensisorange1.1g012444morange1.1g012471morange1.1g015140morange1.1g002052m.24.109orange1.1g002050m.24.109
orange1.1g002027m.24.109
Cucumis sativusCucsa.176290.3Cucsa.176290.1
Eucalyptus grandisEucgr.K02988.2Eucgr.K02988.1Eucgr.K01679.1.16.104
Fragaria vescamrna18850.1-v1.0-hybrid
Glycine maxGlyma03g08980.1Glyma07g17931.1Glyma03g08820.1Glyma03g08930.1Glyma18g42781.1
Glyma03g08910.2Glyma1061s50.2Glyma1061s50.1Glyma03g08850.2Glyma03g08850.1
Glyma0165s00200.1Glyma01g28520.2Glyma01g28520.1Glyma03g08860.1Glyma03g08893.1
Glyma19g30580.1.16.102Glyma03g27600.1.16.103
Gossypium raimondiiGorai.006G181700.3Gorai.006G181700.2Gorai.006G181700.1Gorai.007G379100.3Gorai.007G379100.2
Gorai.007G379100.1Gorai.011G147600.3Gorai.011G147600.2Gorai.011G147600.1Gorai.010G128900.7.16.102
Gorai.010G128900.6.16.102
Linum usitatissimumLus10004826Lus10002495Lus10027767Lus10035528Lus10018226
Lus10041275Lus10031010.16.103Lus10035408.16.103
Malus domesticaMDP0000179937MDP0000520902MDP0000218204MDP0000256086MDP0000293128
MDP0000162900MDP0000149290.20.108
Manihot esculentacassava4.1_014927mcassava4.1_029798mcassava4.1_001086m.16.100
Medicago truncatulaMedtr4g015550.1Medtr7g088740.1.16.104
Mimulus guttatusmgv1a007499mmgv1a000923m.17.105
Oryza sativaLOC_Os01g63810.2LOC_Os01g63810.1LOC_Os05g37450.1LOC_Os07g46790.1.13.101
Panicum virgatumPavirv00009276mPavirv00009275mPavirv00011172mPavirv00049022mPavirv00069370m.17.104
Pavirv00069369m.17.104Pavirv00069371m.17.105
Physcomitrella patensPp1s127_37V6.1Pp1s103_94V6.2Pp1s103_94V6.1Pp1s49_209V6.2Pp1s49_209V6.1
Phaseolus vulgarisPhvul.010G002900.1Phvul.008G105500.1Phvul.001G117500.1
Picea abiesMA_10436655g0010
Populus trichocarpaPotri.009G044800.2Potri.009G044800.1Potri.016G114500.7Potri.016G114500.4Potri.016G114500.3
Potri.016G114500.2Potri.016G114500.1Potri.006G099200.3Potri.006G099200.2Potri.006G099200.1
Prunus persicappa007150mppa020714mppa000429mppa000782m.16.104
Ricinus communis29681.m00133229701.m00061530045.m000475.16.104
Setaria italicaSi002103mSi022447mSi028900m.11.98Si028839m.11.98Si034110m.17.104
Selaginella moellendorffii438530415024440606
Sorghum bicolorSb03g040350.1Sb09g021950.1Sb02g042100.1.13.100
Thellungiella halophilaThhalv10014134mThhalv10013736mThhalv10003634m
Vitis viniferaGSVIVT01033976001GSVIVT01025810001.16.103
Volvox carteriVocar20005575mVocar20005574mVocar20000733mVocar20001112mVocar20009467m
Vocar20004703m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)