y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi2g56102.1
FamilyGT1
Protein PropertiesLength: 621 Molecular Weight: 68097.1 Isoelectric Point: 6.6935
ChromosomeChromosome/Scaffold: 2 Start: 54509878 End: 54518732
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT11745820
  VGTRGDVQPFIALAKRLQEFGHHVRLASHVNFRTFVKSAGVEFYPLGGDPRIMAQYMTKNKGFLMAGPTEISVQRKQVKEIIFSLLPACTEPDLDTGTPF
  RAQAIIANPPAIGHLHIAEALGVPLHIFFTFPWTPTNEFPHPLARTPQSATYRLSYLILDLVIWWGTRGFINDFRKKLNLPPIAYFSTYHGSISHLPTGY
  MWSPHLMPKPNDWGSLVDVVGYCFLNLGTKYQPPLELSQWLQQGSKPIYIGFGSMPLDDEKKVTTTILEALRETGQRGIISRGWGDLGSFSEVPVDVFIL
  EDCPHDWLFPRCTAVVHHGGAGTTAAGLIAGCPTTVVPFFGDQFFWGDIIHARGVGPAPIRVTELTTEALSNAIRFMLDPEVKSRSMELAIAIGNEDGVA
  AAVDSFHRH
Full Sequence
Protein Sequence     Length: 621     Download
MRGMGSNSET VVGEGSGDRK RRGGREAVGA SSSFAEGTRE FVLSSMDERF SGSVDADGFP    60
SLRLEGFGHS KSTTATSGCF KGQEHVFVRS YSDRLLKCDL TLDMLSENEK MKIVEKLVKI    120
QKDGTLEVDV TRSALVASEL SAIDAFGSVP RDVEAVTSGL SKSVPKLKIA MLVVGTRGDV    180
QPFIALAKRL QEFGHHVRLA SHVNFRTFVK SAGVEFYPLG GDPRIMAQYM TKNKGFLMAG    240
PTEISVQRKQ VKEIIFSLLP ACTEPDLDTG TPFRAQAIIA NPPAIGHLHI AEALGVPLHI    300
FFTFPWTPTN EFPHPLARTP QSATYRLSYL ILDLVIWWGT RGFINDFRKK LNLPPIAYFS    360
TYHGSISHLP TGYMWSPHLM PKPNDWGSLV DVVGYCFLNL GTKYQPPLEL SQWLQQGSKP    420
IYIGFGSMPL DDEKKVTTTI LEALRETGQR GIISRGWGDL GSFSEVPVDV FILEDCPHDW    480
LFPRCTAVVH HGGAGTTAAG LIAGCPTTVV PFFGDQFFWG DIIHARGVGP APIRVTELTT    540
EALSNAIRFM LDPEVKSRSM ELAIAIGNED GVAAAVDSFH RHLPSELPLA PPTPPVEEER    600
LDLFQLFSRC LEKCCVPFNL *                                              660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR01426MGT0.0004178577426+
pfam03033Glyco_transf_284.0e-34169313145+
COG1819COG18193.0e-35168581420+
cd03784GT1_Gtf_like3.0e-118168582420+
Gene Ontology
GO TermDescription
GO:0005975carbohydrate metabolic process
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
GO:0030259lipid glycosylation
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACG25324.1046201621sterol 3-beta-glucosyltransferase [Zea mays]
GenBankEEC71863.1019261998525hypothetical protein OsI_04568 [Oryza sativa Indica Group]
RefSeqNP_001044914.1046191619Os01g0867600 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001132100.1046201620hypothetical protein LOC100193516 [Zea mays]
RefSeqXP_002456694.1046201621hypothetical protein SORBIDRAFT_03g040980 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3h4t_A7e-341755759374A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins
PDB3h4i_A7e-341755759374A Chain A, Chimeric Glycosyltransferase For The Generation Of Novel Natural Products
PDB1iir_A1e-301675851404A Chain A, Crystal Structure Of Udp-Glucosyltransferase Gtfb
PDB1rrv_B3e-301675631380A Chain A, X-Ray Crystal Structure Of Tdp-Vancosaminyltransferase Gtfd As A Complex With Tdp And The Natural Substrate, Desvancosaminyl Vancomycin.
PDB1rrv_A3e-301675631380A Chain A, X-Ray Crystal Structure Of Tdp-Vancosaminyltransferase Gtfd As A Complex With Tdp And The Natural Substrate, Desvancosaminyl Vancomycin.
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GT0346713222415610
JG8698462911774670
DT5479143221855050
HO8014273881975820
HO801427541672200.00005
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_034_00218.3Aquca_034_00218.2Aquca_034_00218.1Aquca_023_00154.1Aquca_034_00218.4
Aquca_023_00154.3Aquca_023_00154.2Aquca_114_00011.1Aquca_114_00011.2
Arabidopsis lyrata896855473768910517
Arabidopsis thalianaAT3G07020.2AT3G07020.1AT1G43620.3AT1G43620.2AT1G43620.1
AT5G24750.1
Brachypodium distachyonBradi5g01230.1Bradi3g07997.4Bradi3g07997.3Bradi3g07997.2
Brassica rapaBra001229Bra040355Bra029615Bra020468
Carica papayaevm.model.supercontig_8.181evm.model.supercontig_21.209
Capsella rubellaCarubv10013188mCarubv10013187mCarubv10008593mCarubv10002561m
Chlamydomonas reinhardtiiCre07.g333450.t1.2
Citrus clementinaCiclev10020154mCiclev10011454mCiclev10000559mCiclev10000975m
Citrus sinensisorange1.1g013358morange1.1g006412morange1.1g008369morange1.1g013835morange1.1g047047m
Cucumis sativusCucsa.078450.1Cucsa.140330.2Cucsa.140330.1Cucsa.356970.2Cucsa.078450.2
Cucsa.363720.1
Eucalyptus grandisEucgr.H00810.1Eucgr.B01378.1Eucgr.F02699.1Eucgr.H01372.1Eucgr.B01630.1
Eucgr.F02699.2Eucgr.H01372.2Eucgr.G00612.3Eucgr.G00612.1Eucgr.G00612.2
Fragaria vescamrna16762.1-v1.0-hybridmrna17551.1-v1.0-hybridmrna08139.1-v1.0-hybrid
Glycine maxGlyma03g19751.1Glyma18g28130.2Glyma18g28130.1Glyma18g47490.2Glyma18g47490.1
Glyma02g08940.1Glyma10g36850.2Glyma20g30760.2Glyma20g30760.4Glyma20g30760.3
Glyma09g38830.2Glyma20g30760.6Glyma20g30760.5Glyma02g08940.2Glyma08g19700.2
Gossypium raimondiiGorai.001G184700.2Gorai.001G184700.10Gorai.001G184700.1Gorai.004G058300.2Gorai.004G058300.1
Gorai.004G261100.2Gorai.004G261100.1Gorai.009G254800.4Gorai.009G254800.3Gorai.009G254800.2
Gorai.009G254800.1Gorai.001G184700.3Gorai.009G254800.5Gorai.001G184700.4Gorai.001G184700.5
Gorai.001G184700.7Gorai.001G184700.6Gorai.001G184700.8Gorai.004G261100.3Gorai.008G041600.1
Linum usitatissimumLus10020382Lus10011882Lus10024544Lus10022815Lus10018878
Lus10009556Lus10028572Lus10011883Lus10020381Lus10009557
Malus domesticaMDP0000304346MDP0000278182MDP0000175609MDP0000304996MDP0000152076
MDP0000243097MDP0000771934MDP0000895000
Manihot esculentacassava4.1_004218mcassava4.1_003877mcassava4.1_025328mcassava4.1_014281m
Medicago truncatulaMedtr4g022580.1Medtr7g079430.1Medtr1g098640.2Medtr1g098640.1Medtr1g098640.3
Medtr4g022610.1
Mimulus guttatusmgv1a002910mmgv1a003019mmgv1a022288mmgv1a023756mmgv1a010079m
mgv1a004761mmgv1a005156m
Oryza sativaLOC_Os07g23740.3LOC_Os07g23740.2LOC_Os07g23740.1LOC_Os04g04254.2LOC_Os04g04254.1
LOC_Os01g64750.1LOC_Os04g04240.1LOC_Os02g11940.1
Panicum virgatumPavirv00030954mPavirv00043473mPavirv00043474mPavirv00048943mPavirv00056277m
Pavirv00034065mPavirv00051133m
Physcomitrella patensPp1s90_132V6.1Pp1s245_59V6.1Pp1s110_116V6.1Pp1s159_62V6.1Pp1s281_20V6.1
Pp1s131_65V6.1
Phaseolus vulgarisPhvul.008G056500.2Phvul.008G056500.1Phvul.010G013800.1Phvul.007G080800.1Phvul.004G093900.3
Phvul.004G093900.2Phvul.004G093900.1Phvul.006G212700.1
Picea abiesMA_84359g0010
Populus trichocarpaPotri.014G178300.1Potri.002G067100.1Potri.002G238600.4Potri.002G238600.2Potri.002G238600.1
Potri.002G067100.2Potri.005G193100.1Potri.002G238600.3Potri.003G021100.2Potri.003G021100.1
Prunus persicappa019814mppa002976mppa002535mppa005311m
Ricinus communis30204.m00179130128.m00900929863.m00104933210.m00003430116.m000381
Setaria italicaSi029583mSi009641mSi009639mSi017298m
Selaginella moellendorffii11051343056026840374515406232
Sorghum bicolorSb06g001270.1Sb03g040980.1Sb06g001270.2Sb02g010030.1Sb04g007366.1
Thellungiella halophilaThhalv10020288mThhalv10005442mThhalv10004004m
Vitis viniferaGSVIVT01028556001GSVIVT01034544001GSVIVT01019162001GSVIVT01023003001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)