y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi2g56820.1
FamilyCE8
Protein PropertiesLength: 547 Molecular Weight: 58571.2 Isoelectric Point: 6.9726
ChromosomeChromosome/Scaffold: 2 Start: 55077142 End: 55080092
DescriptionPlant invertase/pectin methylesterase inhibitor superfamily
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE82345380
  ATVCRDGCDYETVKEAVAAAPDDNGGGKRFVVRVKEGVYKESVSVPWEKTNLVLVGDGMGKTVITGDRNADTPGVSTFNTATVGVLADGFMARDLTIANT
  AGPDAHQAVAFRSTGDRTVLDAVELLGHQDTLYAHAMRQFYTRCRVSGTVDFVFGNSAALLHDTLLLVLPRQLHPEKGETDAVTAQGRTDPAQPTGIVLS
  RCAVNGSEEYMAMYRQKPDAHRVYLGRPWKEYSRTVFVGCALAEIVQPQGWMPWSGDFALETLYYGEYDSAGPGGGDRSRSRVKWSSQVPKEHVDVYGVA
  SFIQG
Full Sequence
Protein Sequence     Length: 547     Download
MPPPPLRLLF ILLLLFHIPF SLSSGHSHSR RHRAPAPSPA TPPAASDTAP LPVLLACNAT    60
RFKPVCVSTL SAANATSTPD LLAATLSALR CRIPPAVSTA RSILSSSSSN VNLSSAATNC    120
LTLLSISSHR LSPSPAPSLI SASAALLHLY DCWSAYKYVN TSRTISDAMA YLNDAIAVSS    180
NYISMLAAQI RYGDDTSRWA PPQTERDGYW PSAAADAEAD VDALGVPRGL PADATVCRDG    240
CDYETVKEAV AAAPDDNGGG KRFVVRVKEG VYKESVSVPW EKTNLVLVGD GMGKTVITGD    300
RNADTPGVST FNTATVGVLA DGFMARDLTI ANTAGPDAHQ AVAFRSTGDR TVLDAVELLG    360
HQDTLYAHAM RQFYTRCRVS GTVDFVFGNS AALLHDTLLL VLPRQLHPEK GETDAVTAQG    420
RTDPAQPTGI VLSRCAVNGS EEYMAMYRQK PDAHRVYLGR PWKEYSRTVF VGCALAEIVQ    480
PQGWMPWSGD FALETLYYGE YDSAGPGGGD RSRSRVKWSS QVPKEHVDVY GVASFIQGDK    540
WIPKVQ*                                                              600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02201PLN022019.0e-92229543326+
PLN02713PLN027131.0e-92235544318+
PLN02301PLN023011.0e-94227542321+
pfam01095Pectinesterase6.0e-134233539311+
PLN02708PLN02708053545509+
Gene Ontology
GO TermDescription
GO:0005618cell wall
GO:0030599pectinesterase activity
GO:0042545cell wall modification
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEAY76707.103654629540hypothetical protein OsI_04662 [Oryza sativa Indica Group]
RefSeqNP_001044992.103654629540Os01g0880300 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002306241.104054340555predicted protein [Populus trichocarpa]
RefSeqXP_002309906.102654329561predicted protein [Populus trichocarpa]
RefSeqXP_002458861.1015451506hypothetical protein SORBIDRAFT_03g041680 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1gq8_A02335428308A Chain A, Pectin Methylesterase From Carrot
PDB1xg2_A02305421304B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB1qjv_B1e-2123950714310A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
PDB1qjv_A1e-2123950714310A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
PDB2ntq_B1e-2123950714310A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
Metabolic Pathways
Pathway NameReactionECProtein Name
homogalacturonan degradationRXN-2102EC-3.1.1.11pectinesterase
Signal Peptide
Cleavage Site
23
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EC8888532872595450
EE2896072492595070
EC8990752482595060
CK1624552982515470
EE0286872322594900
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_1260_00001.1Aquca_022_00312.1
Arabidopsis lyrata919784325521
Arabidopsis thalianaAT5G09760.1AT5G64640.1
Brachypodium distachyonBradi5g10700.1
Brassica rapaBra024317Bra028619Bra037786Bra006031Bra009401
Bra028617Bra009400Bra002149
Carica papayaevm.model.supercontig_42.121
Capsella rubellaCarubv10026126mCarubv10000564m
Citrus clementinaCiclev10025271m
Citrus sinensisorange1.1g009085m
Cucumis sativusCucsa.249950.1
Eucalyptus grandisEucgr.H04944.1
Fragaria vescamrna26037.1-v1.0-hybridmrna17879.1-v1.0-hybrid
Glycine maxGlyma05g32380.1Glyma08g15650.1Glyma06g15711.1
Gossypium raimondiiGorai.011G116400.1Gorai.003G067900.1Gorai.007G064900.1
Linum usitatissimumLus10013721Lus10033486Lus10020888Lus10005587
Malus domesticaMDP0000196867MDP0000200773MDP0000233370MDP0000297071MDP0000174996
MDP0000204084MDP0000173284MDP0000174791
Manihot esculentacassava4.1_006847mcassava4.1_004527mcassava4.1_004459mcassava4.1_021091mcassava4.1_005773m
Medicago truncatulaMedtr8g093460.1Medtr3g095920.1
Mimulus guttatusmgv1a004027mmgv1a008938mmgv1a007669mmgv1a003977mmgv1a019250m
Oryza sativaLOC_Os01g65790.1LOC_Os04g35770.1
Panicum virgatumPavirv00054696mPavirv00008464mPavirv00032807mPavirv00008364m
Physcomitrella patensPp1s382_22V6.1Pp1s216_42V6.1Pp1s151_23V6.2Pp1s76_125V6.1Pp1s151_23V6.1
Phaseolus vulgarisPhvul.002G270900.1Phvul.009G148900.1
Picea abiesMA_10430460g0010.462.762MA_10427058g0010.383.512MA_10427058g0010.383.512MA_10427058g0010.79.248MA_10427058g0010.79.248
MA_906551g0010MA_2253g0010MA_54974g0010MA_68362g0010MA_10430460g0010.462.762
MA_67675g0010MA_495624g0010
Populus trichocarpaPotri.005G061500.1Potri.007G107300.2Potri.007G107300.3Potri.007G107300.1
Prunus persicappa021056mppa024386mppa003915m
Ricinus communis30136.m001028
Setaria italicaSi005458mSi010057m
Selaginella moellendorffii8374476314420760
Sorghum bicolorSb06g017280.1Sb03g041680.1
Thellungiella halophilaThhalv10013067mThhalv10003853m
Vitis viniferaGSVIVT01026518001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)