y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi2g57420.1
FamilyGH20
Protein PropertiesLength: 522 Molecular Weight: 58645.6 Isoelectric Point: 5.5683
ChromosomeChromosome/Scaffold: 2 Start: 55590181 End: 55595467
Descriptionbeta-hexosaminidase 3
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH201604720
  WMITDAPRFPYRGLLIDTSRHYLPLTTIKGVIDAMTYSKLNVLHWHIIDEQSFPIEIPSYPKLWNGSYSYSERYTMSDAVDIVRYAEKRGVNVLAEIDVP
  GHALSWGVGYPSLWPSDSCKEALDVSNNFTFEVIDGILSDFSKVFKFKFVHLGGDEVNTSCWTKTPHIKEWLNNNHMNASDAYRYFVLRSQKIAIAHGYD
  VINWEETFNDFGEKLDRKTIVHNWLGGKVAPKVVAAGLRCIVSNQDKWYLDHLDATWEGFYMNEPLKGIDNPEQQRLVIGGEVCMWGEQIDASDIEQTIW
  PRAAAAAERLWTP
Full Sequence
Protein Sequence     Length: 522     Download
MAQALRPLLV LLAIGSCIAA DHIDLWPMPK SVTHGAQRLY VSKDATMSMV GSTYSDEKAI    60
LKDAFQRMLD LMKLNHNADD TNRSSFVLTG VNMVVHSPED ELSFGVDESY NLTVPTIGDP    120
LHAQVEAQTV YGALHALQTF GQLCYFDFTS RLIELNSAPW MITDAPRFPY RGLLIDTSRH    180
YLPLTTIKGV IDAMTYSKLN VLHWHIIDEQ SFPIEIPSYP KLWNGSYSYS ERYTMSDAVD    240
IVRYAEKRGV NVLAEIDVPG HALSWGVGYP SLWPSDSCKE ALDVSNNFTF EVIDGILSDF    300
SKVFKFKFVH LGGDEVNTSC WTKTPHIKEW LNNNHMNASD AYRYFVLRSQ KIAIAHGYDV    360
INWEETFNDF GEKLDRKTIV HNWLGGKVAP KVVAAGLRCI VSNQDKWYLD HLDATWEGFY    420
MNEPLKGIDN PEQQRLVIGG EVCMWGEQID ASDIEQTIWP RAAAAAERLW TPIEKLAEDP    480
RSATSRLSRF RCLLNQRGVA AAPLAGDGRT APYEPGPCVR Q*                       540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd02742GH20_hexosaminidase1.0e-57170470323+
cd06570GH20_chitobiase-like_15.0e-69168472318+
cd06563GH20_chitobiase-like3.0e-69168475354+
pfam00728Glyco_hydro_206.0e-102168472335+
cd06562GH20_HexA_HexB-like5.0e-155168498350+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004563beta-N-acetylhexosaminidase activity
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAT77374.102352127527putative beta-N-acetylhexosaminidase [Oryza sativa Japonica Group]
GenBankACN36154.102152125525unknown [Zea mays]
GenBankEEC79230.102352127527hypothetical protein OsI_19972 [Oryza sativa Indica Group]
RefSeqNP_001045052.101452116526Os01g0891000 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001055557.102352131531Os05g0415700 [Oryza sativa (japonica cultivar-group)]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2gk1_H0255047497B Chain B, X-Ray Crystal Structure Of Ngt-Bound Hexa
PDB2gk1_F0255047497B Chain B, X-Ray Crystal Structure Of Ngt-Bound Hexa
PDB2gk1_D0255047497B Chain B, X-Ray Crystal Structure Of Ngt-Bound Hexa
PDB2gk1_B0255047497B Chain B, X-Ray Crystal Structure Of Ngt-Bound Hexa
PDB1o7a_F02550415505A Chain A, Human Beta-Hexosaminidase B
Metabolic Pathways
Pathway NameReactionECProtein Name
chitin degradation IIRXN-12625EC-3.2.1.52β-L-N-acetylhexosaminidase
chitin degradation IIRXN-12626EC-3.2.1.52β-L-N-acetylhexosaminidase
Signal Peptide
Cleavage Site
19
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CK2104943211975170
GO8454713191424600
HO8039823981275220
ES3024942851043880
CV7348973681014680
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_022_00071.4Aquca_022_00071.3Aquca_022_00071.2Aquca_022_00071.1Aquca_010_00682.1
Aquca_004_00645.1
Arabidopsis lyrata475658485946470561
Arabidopsis thalianaAT1G65590.1AT3G55260.1AT1G05590.1
Brachypodium distachyonBradi2g25310.1Bradi2g37460.1Bradi3g44607.1Bradi1g69660.1Bradi1g23740.1
Brassica rapaBra004121Bra014765Bra032460
Carica papayaevm.model.supercontig_197.26
Capsella rubellaCarubv10020116mCarubv10016974mCarubv10011603m
Chlamydomonas reinhardtiig11709.t1
Citrus clementinaCiclev10014808mCiclev10031174mCiclev10031139mCiclev10031669mCiclev10033772m
Ciclev10019509mCiclev10024601m
Citrus sinensisorange1.1g008945morange1.1g013337morange1.1g008821morange1.1g014971morange1.1g044344m
orange1.1g007722morange1.1g007610m
Cucumis sativusCucsa.165600.1Cucsa.178740.1Cucsa.165600.2.144.314Cucsa.165600.2.144.314Cucsa.177460.1
Cucsa.165600.2.312.421Cucsa.165600.2.312.421
Eucalyptus grandisEucgr.G02896.1Eucgr.L01476.1Eucgr.K02799.2Eucgr.K02799.1Eucgr.K02799.3
Eucgr.K02798.2Eucgr.K02798.1
Fragaria vescamrna26730.1-v1.0-hybridmrna02330.1-v1.0-hybrid
Glycine maxGlyma18g52290.1Glyma02g10570.1Glyma10g43710.1Glyma20g38400.1Glyma08g17200.1
Glyma08g16970.1Glyma15g41986.1
Gossypium raimondiiGorai.002G136400.2Gorai.002G136400.1Gorai.011G246500.1Gorai.012G068200.1Gorai.012G068200.2
Gorai.002G136400.3Gorai.012G068200.3Gorai.007G264000.1
Linum usitatissimumLus10003292Lus10030323Lus10022251Lus10030348Lus10007899
Malus domesticaMDP0000798095MDP0000262060.270.444MDP0000262060.270.444MDP0000564236MDP0000262060.174.257
MDP0000262060.174.257
Manihot esculentacassava4.1_033827mcassava4.1_033064mcassava4.1_004406mcassava4.1_007813mcassava4.1_023099m
cassava4.1_021615m
Medicago truncatulaMedtr2g062560.1
Mimulus guttatusmgv1a004365mmgv1a003720mmgv1a007861mmgv1a003512mmgv1a023788m
Oryza sativaLOC_Os01g66700.1LOC_Os05g34320.2LOC_Os05g34320.1LOC_Os05g02510.1LOC_Os05g34320.3
LOC_Os07g38790.1LOC_Os03g11980.1
Panicum virgatumPavirv00023753mPavirv00005093mPavirv00062644mPavirv00067910mPavirv00063863m
Pavirv00062646mPavirv00001875mPavirv00056279mPavirv00062645m.258.396Pavirv00062645m.258.396
Pavirv00060770mPavirv00016511mPavirv00054866mPavirv00049460mPavirv00062645m.174.254
Pavirv00062645m.174.254
Physcomitrella patensPp1s70_132V6.1Pp1s3_199V6.1
Phaseolus vulgarisPhvul.008G015400.1Phvul.007G010100.1Phvul.005G045300.1Phvul.005G043200.1
Picea abiesMA_177334g0010MA_271570g0010MA_92690g0010.179.289MA_92690g0010.179.289MA_92690g0010.297.429
MA_92690g0010.297.429
Populus trichocarpaPotri.008G079400.2Potri.008G079400.1Potri.010G211000.2Potri.010G211000.1Potri.010G211000.4
Potri.010G211000.3Potri.008G079400.5Potri.008G079400.3Potri.008G079400.4Potri.001G232800.1
Potri.001G232600.1
Prunus persicappa003880mppa002753m
Ricinus communis29929.m00450328180.m00037729616.m00021628180.m00037634575.m000024
47890.m000013
Setaria italicaSi001028mSi021738mSi024695mSi021693mSi029311m
Si034794m
Selaginella moellendorffii117332429308422139422155445016
422160429325441789422260
Sorghum bicolorSb09g020420.2Sb09g020420.1Sb09g001670.1Sb02g037280.1Sb01g042640.1
Thellungiella halophilaThhalv10018379mThhalv10010264mThhalv10007181mThhalv10007179m
Vitis viniferaGSVIVT01016639001GSVIVT01006264001GSVIVT01004010001GSVIVT01006000001
Volvox carteriVocar20013124m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)