y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi2g58060.1
FamilyGT21
Protein PropertiesLength: 518 Molecular Weight: 58355.8 Isoelectric Point: 8.6283
ChromosomeChromosome/Scaffold: 2 Start: 56076829 End: 56081437
DescriptionNucleotide-diphospho-sugar transferases superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT21842657.8e-33
  PRVSVIMPLKGFGEHNLQNWRTQITSLYGGPVEFLFVVESKDDPAYRAVSCLIVDYKDKLEAKVVVAGFSTTCSQKIHNQLIGVEKMHKDSKYVLFLDDD
  VRLHPGTIGALTKEMVKNPEIFIQTGYPLDLPSGSLGSYCIYEYHMPCSIGFATGGRTFFLWGGCMMMHADDFRQDLYGLVT
Full Sequence
Protein Sequence     Length: 518     Download
MAAMAAADAM LAAASRAVCS SVAVFFQIQG CCICLLLALG WTVASFVRKK EIRKMRRKMI    60
DGNSFAFLCD DVDELEHSVQ EKLPRVSVIM PLKGFGEHNL QNWRTQITSL YGGPVEFLFV    120
VESKDDPAYR AVSCLIVDYK DKLEAKVVVA GFSTTCSQKI HNQLIGVEKM HKDSKYVLFL    180
DDDVRLHPGT IGALTKEMVK NPEIFIQTGY PLDLPSGSLG SYCIYEYHMP CSIGFATGGR    240
TFFLWGGCMM MHADDFRQDL YGLVTGLRNG GYSDDMTLAA IAGQHKRLIT SPPVAVFPHP    300
LASDLSFSRY WNYLRKQTFV LESYVSKVNW MMNRALFATH CYLSWGFICP YAMALVHVAA    360
FVRAPYSAIV KEASDSSFGL KLVSFLFICT LTELVSMWNL TRVEIQLCNM LSPEGPKDSL    420
RSYNWGLVFI AVLVDNFLYP ISAFRSHFSQ SINWSGIRYY LRDGKISKIE RENRSKYTDL    480
GGKHLYSKRT YPPGKSLFGC SFLMSLVQWH QPKKYDV*                            540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd04186GT_2_like_c4.0e-516125898+
pfam13641Glyco_tranf_2_32.0e-584250174+
cd02520Glucosylceramide_synthase2.0e-984196116+
COG1215COG12151.0e-982398333+
pfam13506Glyco_transf_211.0e-11148315172+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACN34031.101551716517unknown [Zea mays]
DDBJBAD82732.101551713515putative ceramide glucosyltransferase [Oryza sativa Japonica Group]
GenBankEEC71990.101551716504hypothetical protein OsI_04841 [Oryza sativa Indica Group]
GenBankEEE55846.101551716504hypothetical protein OsJ_04465 [Oryza sativa Japonica Group]
RefSeqXP_002458945.101551716517hypothetical protein SORBIDRAFT_03g043150 [Sorghum bicolor]
Metabolic Pathways
Pathway NameReactionECProtein Name
sphingolipid biosynthesis (plants)RXN-7793EC-2.4.1.80ceramide glucosyltransferase
Transmembrane Domains
StartEnd
2547
341363
378400
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
JG8634482841254080
CJ727431260623210
FE6984232881254110
CA2529212912255150
GT0333772961264200
Orthologous Group
SpeciesID
Arabidopsis lyrata319569
Arabidopsis thalianaAT2G19880.1AT2G19880.2
Brassica rapaBra036698Bra039028Bra031106
Carica papayaevm.model.supercontig_40.95
Capsella rubellaCarubv10013384m
Citrus clementinaCiclev10008006m
Citrus sinensisorange1.1g010062m
Cucumis sativusCucsa.288830.1
Eucalyptus grandisEucgr.C03729.1
Fragaria vescamrna11297.1-v1.0-hybrid
Glycine maxGlyma08g03760.1Glyma01g01130.1Glyma05g35860.2Glyma16g08510.1
Gossypium raimondiiGorai.010G077100.1Gorai.010G077100.2Gorai.009G027500.1Gorai.009G027500.2
Linum usitatissimumLus10034973
Malus domesticaMDP0000289917MDP0000035240MDP0000126193
Manihot esculentacassava4.1_005602mcassava4.1_007721m
Medicago truncatulaMedtr8g102490.1Medtr8g102500.1
Mimulus guttatusmgv1a004497mmgv1a004580m
Oryza sativaLOC_Os01g67870.1
Panicum virgatumPavirv00019095mPavirv00063321m
Physcomitrella patensPp1s194_131V6.1
Phaseolus vulgarisPhvul.004G176200.1Phvul.002G308700.1
Populus trichocarpaPotri.018G087700.3Potri.018G087700.2Potri.018G087700.1Potri.006G164800.2Potri.T063300.1
Potri.006G164800.1
Prunus persicappa004285mppa005382m
Ricinus communis29912.m005431
Setaria italicaSi001058m
Selaginella moellendorffii74622
Sorghum bicolorSb03g043150.1
Thellungiella halophilaThhalv10001962m
Vitis viniferaGSVIVT01015303001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny