y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi2g58616.1
FamilyGT41
Protein PropertiesLength: 983 Molecular Weight: 110130 Isoelectric Point: 6.916
ChromosomeChromosome/Scaffold: 2 Start: 56429844 End: 56438371
DescriptionTetratricopeptide repeat (TPR)-like superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT415927500
  DRTSRLRIGYVSSDFGNHPLSHLMGSVFGMHDQDTIEVFCYALSKDDGTEWRQRIQSEAEHFIDVSTMSSDMIAKVINEDKIQILINLNGYTKGARNEIF
  AMQPAPIQVSYMGFPGTTGASYIDYLVTDEFVSPLKFSHIYSEKLVHLPHCYFVNDYKK
GT417619650
  PHKRADYGLPEDKFIFACFNQLYKMDPDIFGTWCNIVKRVPNSALWLLRFPPAGEMRLRAYAISKGVRADQIIFTDVAAKSEHIRRSALADLFLDTPLCN
  GHTTGTDILWAGLPMITLPLEKMATRVAGSLCRATGIGEEMIVSSLKEYEERAVFLAKNPSKLQALTNKLKAVRMTCPLFDTSRWVKNLDRAYLKMWHLY
  CLGRH
Full Sequence
Protein Sequence     Length: 983     Download
MLSVRGGGVA AAGAEQRGIH PHPDHPTPWL RQHLGAAINS LPQNPLEVDE DAHLGIAQQS    60
YNAGDYRAAL EHCNAVYMVN PRRLENLLLL GAVYYQLREF DMCIVRNSEA VQIQPNFPEC    120
VNNMANAWRE KGDIDCAIQL YDHATKDKFI PTLQLRPTFA DAWANLANAY TRKGNLSKAV    180
GCYHQAIALN PRLVDAYCNL GDVLKAQGLY SDAYNCYVNA LSVEPSSANA WYYIAGLFMQ    240
WGDPSKAVLY YKEAIKYKPS FYDAHLNLGN LYKAVGMHQD AIVCYQNAVR ASPDNDIAYG    300
TLANTYYEQG QLDLAIRSYR QAINCNSSYV EAYNNLGNAL KDAGKSDEAI GCYEKCLALQ    360
PSHPQALTNL GNVYMERNMM DVAASLYMAT LTVTTGLSAP YNNLAIIYKQ QGEYDRALTC    420
YNEVLRIDPT AADCLVNRGN TLKETGRVSE AIQDYFRAIA IRPAMAEAHA NLASAYKDTG    480
LLEAAIVSYR HALQCRGDFP EATCNLLHTR QCVCDWDDRE EKFIEVEGII RRHIKNSLLP    540
SVQPFHAIAY PLDPTLALEI SKKYAAHYSM VASRFGLPKF MHPSGVPVNT GDRTSRLRIG    600
YVSSDFGNHP LSHLMGSVFG MHDQDTIEVF CYALSKDDGT EWRQRIQSEA EHFIDVSTMS    660
SDMIAKVINE DKIQILINLN GYTKGARNEI FAMQPAPIQV SYMGFPGTTG ASYIDYLVTD    720
EFVSPLKFSH IYSEKLVHLP HCYFVNDYKK KNQDALDQVC PHKRADYGLP EDKFIFACFN    780
QLYKMDPDIF GTWCNIVKRV PNSALWLLRF PPAGEMRLRA YAISKGVRAD QIIFTDVAAK    840
SEHIRRSALA DLFLDTPLCN GHTTGTDILW AGLPMITLPL EKMATRVAGS LCRATGIGEE    900
MIVSSLKEYE ERAVFLAKNP SKLQALTNKL KAVRMTCPLF DTSRWVKNLD RAYLKMWHLY    960
CLGRHPQHFK VLEDNTQIVN SP*                                            1020
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR02917PEP_TPR_lipo2.0e-3031506578+
pfam13844Glyco_transf_412.0e-68597750155+
pfam13844Glyco_transf_411.0e-72764957194+
COG3914Spy2.0e-99402960572+
Gene Ontology
GO TermDescription
GO:0005515protein binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEEC73199.1026978541000hypothetical protein OsI_07263 [Oryza sativa Indica Group]
GenBankEEE57013.1026978541000hypothetical protein OsJ_06783 [Oryza sativa Japonica Group]
RefSeqXP_002270163.104797659980PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002319130.10499751919predicted protein [Populus trichocarpa]
RefSeqXP_002453843.103978281007hypothetical protein SORBIDRAFT_04g019560 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4gz6_D03617486390A Chain A, X-Ray Crystal Structure Of Tdp-Vancosaminyltransferase Gtfd As A Complex With Tdp And The Natural Substrate, Desvancosaminyl Vancomycin.
PDB4gz6_D0745969495718A Chain A, X-Ray Crystal Structure Of Tdp-Vancosaminyltransferase Gtfd As A Complex With Tdp And The Natural Substrate, Desvancosaminyl Vancomycin.
PDB4gz6_D2e-211152756158A Chain A, X-Ray Crystal Structure Of Tdp-Vancosaminyltransferase Gtfd As A Complex With Tdp And The Natural Substrate, Desvancosaminyl Vancomycin.
PDB4gz6_D1e-181573046153A Chain A, X-Ray Crystal Structure Of Tdp-Vancosaminyltransferase Gtfd As A Complex With Tdp And The Natural Substrate, Desvancosaminyl Vancomycin.
PDB4gz6_D2e-181913416156A Chain A, X-Ray Crystal Structure Of Tdp-Vancosaminyltransferase Gtfd As A Complex With Tdp And The Natural Substrate, Desvancosaminyl Vancomycin.
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7952474555239770
HO7787254445349770
GT0341503276309560
GO8815533255989220
HO795247514715210.00000000004
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_058_00216.4.161.321Aquca_058_00216.4.161.321Aquca_058_00216.3.387.547Aquca_058_00216.3.387.547Aquca_058_00216.2
Aquca_058_00216.1.601.761Aquca_058_00216.1.601.761Aquca_072_00077.2Aquca_072_00077.3Aquca_072_00077.1
Arabidopsis lyrata896453.457.745896453.457.745478494
Arabidopsis thalianaAT3G04240.1.457.745AT3G04240.1.457.745AT3G11540.1AT3G11540.2
Brachypodium distachyonBradi3g43577.3.610.769Bradi3g43577.3.610.769Bradi3g43577.2Bradi3g43577.1Bradi5g06647.1.621.781
Bradi5g06647.1.621.781Bradi2g58616.1.592.750Bradi2g58616.1.592.750Bradi3g42910.1
Brassica rapaBra040144.586.743Bra040144.586.743Bra001408Bra034832
Carica papayaevm.model.supercontig_51.46.234.522evm.model.supercontig_51.46.234.522
Capsella rubellaCarubv10012900m.457.745Carubv10012900m.457.745Carubv10013012mCarubv10012928m
Chlamydomonas reinhardtiig13482.t1
Citrus clementinaCiclev10018711m.453.741Ciclev10018711m.453.741Ciclev10011210mCiclev10011021m
Citrus sinensisorange1.1g003557m.291.579orange1.1g003557m.291.579orange1.1g002729m.402.690orange1.1g002729m.402.690orange1.1g002431m.402.690
orange1.1g002431m.402.690orange1.1g005626morange1.1g005594morange1.1g004753morange1.1g007075m
orange1.1g002273morange1.1g003891morange1.1g002443morange1.1g002441morange1.1g002438m
orange1.1g006937morange1.1g007634m
Cucumis sativusCucsa.027630.1.563.753Cucsa.027630.1.563.753Cucsa.083560.1
Eucalyptus grandisEucgr.L00641.1.550.718Eucgr.L00641.1.550.718Eucgr.K02568.1
Fragaria vescamrna16720.1-v1.0-hybrid.551.739mrna16720.1-v1.0-hybrid.551.739mrna15637.1-v1.0-hybrid
Glycine maxGlyma10g31190.2Glyma10g31190.1.468.756Glyma10g31190.1.468.756Glyma20g36330.1.468.756Glyma20g36330.1.468.756
Glyma20g36330.2Glyma19g38241.2Glyma19g38241.1Glyma03g35610.3Glyma03g35610.2
Glyma02g36210.4Glyma02g36210.3Glyma10g08710.1
Gossypium raimondiiGorai.011G150500.2.480.766Gorai.011G150500.2.480.766Gorai.011G150500.1.481.772Gorai.011G150500.1.481.772Gorai.011G150500.3
Gorai.013G189100.3.376.564Gorai.013G189100.3.376.564Gorai.013G189100.2.571.758Gorai.013G189100.2.571.758Gorai.013G189100.1.571.758
Gorai.013G189100.1.571.758Gorai.011G150500.5.520.693Gorai.011G150500.5.520.693Gorai.011G150500.4.520.693Gorai.011G150500.4.520.693
Gorai.007G367900.2Gorai.007G367900.1Gorai.002G238200.2Gorai.002G238200.1
Linum usitatissimumLus10003576.450.737Lus10003576.450.737Lus10004779.456.744Lus10004779.456.744Lus10003113.456.744
Lus10003113.456.744Lus10021336Lus10017009
Malus domesticaMDP0000233292.459.747MDP0000233292.459.747MDP0000119499MDP0000212192MDP0000846748
Manihot esculentacassava4.1_001015m.583.740cassava4.1_001015m.583.740cassava4.1_002695m.313.473cassava4.1_002695m.313.473cassava4.1_002691m.313.473
cassava4.1_002691m.313.473cassava4.1_001021m.581.740cassava4.1_001021m.581.740cassava4.1_001222mcassava4.1_001239m
cassava4.1_001390m
Medicago truncatulaMedtr1g079510.2.224.512Medtr1g079510.2.224.512Medtr1g079510.1.466.754Medtr1g079510.1.466.754
Mimulus guttatusmgv1a000777m.468.756mgv1a000777m.468.756mgv1a000982m.534.691mgv1a000982m.534.691mgv1a000971m
Oryza sativaLOC_Os01g68680.1.495.747LOC_Os01g68680.1.495.747LOC_Os02g28830.1.255.415LOC_Os02g28830.1.255.415LOC_Os08g44510.1
Panicum virgatumPavirv00063187m.616.777Pavirv00063187m.616.777Pavirv00007611mPavirv00052192m
Physcomitrella patensPp1s263_4V6.1.478.766Pp1s263_4V6.1.478.766Pp1s177_132V6.1.476.764Pp1s177_132V6.1.476.764Pp1s346_18V6.1
Pp1s456_4V6.1Pp1s150_16V6.1
Phaseolus vulgarisPhvul.007G119800.1.469.757Phvul.007G119800.1.469.757Phvul.001G192300.2Phvul.001G192300.1Phvul.007G153100.2
Phvul.007G153100.1
Picea abiesMA_76964g0020.246.533MA_76964g0020.246.533MA_247226g0010.309.469MA_247226g0010.309.469MA_869746g0010
MA_475186g0010MA_261690g0010
Populus trichocarpaPotri.013G051400.7.84.372Potri.013G051400.7.84.372Potri.013G051400.6.224.512Potri.013G051400.6.224.512Potri.013G051400.5
Potri.013G051400.4.463.751Potri.013G051400.4.463.751Potri.013G051400.3.463.751Potri.013G051400.3.463.751Potri.013G051400.2.463.751
Potri.013G051400.2.463.751Potri.013G051400.1.463.751Potri.013G051400.1.463.751Potri.019G025600.5.224.512Potri.019G025600.5.224.512
Potri.019G025600.2.459.747Potri.019G025600.2.459.747Potri.019G025600.1.459.747Potri.019G025600.1.459.747Potri.019G025600.6.213.376
Potri.019G025600.6.213.376Potri.019G025600.4.417.580Potri.019G025600.4.417.580Potri.019G025600.3.478.641Potri.019G025600.3.478.641
Potri.006G208900.1Potri.016G075700.4Potri.016G075700.3Potri.016G075700.1Potri.016G075700.2
Potri.006G208900.3Potri.006G208900.2
Prunus persicappa000862m.459.747ppa000862m.459.747ppa001075m
Ricinus communis29680.m001749.589.74729680.m001749.589.74727556.m00005030032.m00047548742.m000013
Setaria italicaSi016363mSi016197m.619.779Si016197m.619.779Si000265m.480.641Si000265m.480.641
Si013329mSi013225m
Selaginella moellendorffii143846.391.643143846.391.643159012
Sorghum bicolorSb04g019560.1.619.779Sb04g019560.1.619.779Sb07g024110.1
Thellungiella halophilaThhalv10020104mThhalv10020000m.431.719Thhalv10020000m.431.719Thhalv10019996m.457.745Thhalv10019996m.457.745
Thhalv10020052mThhalv10020017m
Vitis viniferaGSVIVT01026359001.593.754GSVIVT01026359001.593.754GSVIVT01033891001
Volvox carteriVocar20006483m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)