y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi2g61010.1
FamilyGH2
Protein PropertiesLength: 1120 Molecular Weight: 126225 Isoelectric Point: 6.1515
ChromosomeChromosome/Scaffold: 2 Start: 58209279 End: 58216738
Descriptionglycoside hydrolase family 2 protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH2889840
  YAQSLSGYWKFHLAQSPESVPEKFYDAQFSDSDWEALPVPSNWQMHGFDRPIYTNVTYPFPMNPPFVPSENPTGCYRKVFHIPKEWKGRRILLHFEAVDS
  AFLAWVNGVPIGYSQDSRLPAEFEITDCCHHCDSGKENVLAVQVMRWSDGSYLEDQDHWWLSGIHRDVLLLSKPEIFITDYFFKATLDENFLVADIEVEV
  EIDSHKQDREHISTLSIEAKLFDNSVPSGGLNSDMSAANVVNLKAKPKPKPSHCHGFHGYVLGGKVENPKLWSSEKPNLYTLVVLLKDAKGKLIECESCQ
  VGIRGVVLAHKQMLVNGCPVVIRGVNRHEHHPRVGKTNIEACMIKDLVLMRQNNINAVRNCHYPQHPRWYELCDIFGLYVIDEANIETHGFDESSSFKHP
  TLESIWTNCMLDRVVSMVERDKNHACIIVWSLGNESSYGPNHSAMSGWVRGRDPTRLIHYEGGGSRTSSTDIVCPMYMRVWDILKIANDPSENRPLILCE
  YSHAMGNSNGNIDAYWMAIDSTMGLQGGFIWDWVDQGLLKEDVNGSKFWAYGGDFGDTPNDSNFCLNGIVWPDRTIHPAVYEVKHLYQPIKISLMDNTLK
  INNAQFSETTEALDFSWILHGDGCVLGSGSLDLPDIAPQSSHLINMQSSPWFTLWSACAAKETFLSINVKLGGQTRWSKDGHILASAQLCLPQTNSFVPH
  VIALSRSPLVSEHVGDSVIISKNKDWQIKVNTRSGTIDSWKINNIELLSKGILPCFWRAPTDNDNGGFYTKSYATRWREAFLDNIVFRSSQFSVKELPDH
  AVEISTTYYGLPGHLVKPDDAALSEAPESTLFQVPMRCRMYESGDVILEYEVNPKSDLPPLPRIGIVFNTEKSLSHVTWYGRGPFECYPDRKAAAHV
Full Sequence
Protein Sequence     Length: 1120     Download
MALASASGAM FPPTNSASKP WEDPSFFRWR KREAHVPLRS HDTLEGALKY WHERRNVSYL    60
DSESAVWDDD AVRGALESAA FWSQGLPYAQ SLSGYWKFHL AQSPESVPEK FYDAQFSDSD    120
WEALPVPSNW QMHGFDRPIY TNVTYPFPMN PPFVPSENPT GCYRKVFHIP KEWKGRRILL    180
HFEAVDSAFL AWVNGVPIGY SQDSRLPAEF EITDCCHHCD SGKENVLAVQ VMRWSDGSYL    240
EDQDHWWLSG IHRDVLLLSK PEIFITDYFF KATLDENFLV ADIEVEVEID SHKQDREHIS    300
TLSIEAKLFD NSVPSGGLNS DMSAANVVNL KAKPKPKPSH CHGFHGYVLG GKVENPKLWS    360
SEKPNLYTLV VLLKDAKGKL IECESCQVGI RGVVLAHKQM LVNGCPVVIR GVNRHEHHPR    420
VGKTNIEACM IKDLVLMRQN NINAVRNCHY PQHPRWYELC DIFGLYVIDE ANIETHGFDE    480
SSSFKHPTLE SIWTNCMLDR VVSMVERDKN HACIIVWSLG NESSYGPNHS AMSGWVRGRD    540
PTRLIHYEGG GSRTSSTDIV CPMYMRVWDI LKIANDPSEN RPLILCEYSH AMGNSNGNID    600
AYWMAIDSTM GLQGGFIWDW VDQGLLKEDV NGSKFWAYGG DFGDTPNDSN FCLNGIVWPD    660
RTIHPAVYEV KHLYQPIKIS LMDNTLKINN AQFSETTEAL DFSWILHGDG CVLGSGSLDL    720
PDIAPQSSHL INMQSSPWFT LWSACAAKET FLSINVKLGG QTRWSKDGHI LASAQLCLPQ    780
TNSFVPHVIA LSRSPLVSEH VGDSVIISKN KDWQIKVNTR SGTIDSWKIN NIELLSKGIL    840
PCFWRAPTDN DNGGFYTKSY ATRWREAFLD NIVFRSSQFS VKELPDHAVE ISTTYYGLPG    900
HLVKPDDAAL SEAPESTLFQ VPMRCRMYES GDVILEYEVN PKSDLPPLPR IGIVFNTEKS    960
LSHVTWYGRG PFECYPDRKA AAHVGVYESS VEDLHVPYIV PGECGGRADV RWTALRNAEG    1020
FGLFASVHGE SPPMQMSASY YGAAELDRAT HKHKLVKGDD IEVHLDHRHM GLGGDDSWTP    1080
CVHEQYLLPP DRRYAFSVRL RPLLPSTSCD DIYRSQLPH*                          1140
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
smart01038Bgal_small_N1.0e-868091100293+
pfam02836Glyco_hydro_2_C3.0e-112393679297+
COG3250LacZ7.0e-16890982903+
PRK09525lacZ01711021116+
PRK10340ebgA07510861021+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004565beta-galactosidase activity
GO:0005975carbohydrate metabolic process
GO:0009341beta-galactosidase complex
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEEC72176.101111811031hypothetical protein OsI_05227 [Oryza sativa Indica Group]
RefSeqNP_001045421.101111811116Os01g0952600 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002266400.103111711112PREDICTED: hypothetical protein isoform 1 [Vitis vinifera]
RefSeqXP_002266434.103111711113PREDICTED: hypothetical protein isoform 2 [Vitis vinifera]
RefSeqXP_002513059.103111611107beta-galactosidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3muy_409010925210131 Chain 1, E. Coli (Lacz) Beta-Galactosidase (R599a)
PDB3muy_309010925210131 Chain 1, E. Coli (Lacz) Beta-Galactosidase (R599a)
PDB3muy_209010925210131 Chain 1, E. Coli (Lacz) Beta-Galactosidase (R599a)
PDB3muy_109010925210131 Chain 1, E. Coli (Lacz) Beta-Galactosidase (R599a)
PDB1jz2_D09010925210131 Chain 1, E. Coli (Lacz) Beta-Galactosidase (R599a)
Metabolic Pathways
Pathway NameReactionECProtein Name
lactose degradation IIIBETAGALACTOSID-RXNEC-3.2.1.23β-galactosidase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DV4768932563716260
EG3970692724026730
HO8042743911315160
CB626663279403180
HO804274505025500.0000001
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00605.1Aquca_014_00605.2
Arabidopsis lyrata485844
Arabidopsis thalianaAT3G54440.1AT3G54440.2AT3G54440.3
Brassica rapaBra014816
Carica papayaevm.model.supercontig_540.3
Capsella rubellaCarubv10019396m
Chlamydomonas reinhardtiiCre08.g379450.t1.3
Citrus clementinaCiclev10030068mCiclev10027821m
Citrus sinensisorange1.1g004315morange1.1g004363morange1.1g006933morange1.1g023943morange1.1g023667m
orange1.1g022918morange1.1g007038m
Cucumis sativusCucsa.307940.11Cucsa.307940.1Cucsa.307940.12
Eucalyptus grandisEucgr.J01181.1
Fragaria vescamrna14286.1-v1.0-hybrid
Glycine maxGlyma13g26700.1Glyma15g37670.1
Gossypium raimondiiGorai.010G216500.1
Linum usitatissimumLus10024155Lus10039520Lus10039519
Manihot esculentacassava4.1_002723m
Medicago truncatulaMedtr8g039160.1
Mimulus guttatusmgv1a000801m
Oryza sativaLOC_Os01g72340.1
Panicum virgatumPavirv00010284mPavirv00069653m
Physcomitrella patensPp1s130_43V6.1
Phaseolus vulgarisPhvul.011G206800.1
Picea abiesMA_10429668g0010
Populus trichocarpaPotri.003G196500.1Potri.003G196500.2Potri.001G027400.1
Prunus persicappa000508mppa000532m
Ricinus communis30131.m007196
Setaria italicaSi000118mSi000119m
Selaginella moellendorffii181800
Sorghum bicolorSb03g046050.2Sb03g046050.1
Thellungiella halophilaThhalv10010080m
Vitis viniferaGSVIVT01013489001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny