y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi3g01150.1
FamilyGT22
Protein PropertiesLength: 546 Molecular Weight: 62583.2 Isoelectric Point: 9.7153
ChromosomeChromosome/Scaffold: 3 Start: 731911 End: 735878
DescriptionAlg9-like mannosyltransferase family
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT22404500
  LALAMAFRAANALLVRTYFNPDEHWQCLEVAHRIAFGYGHLTWEWKRGLRGYLHPLIFAALYKFLAFLHLDTPWFMAMAPRLLQSVFASFGDLYLYKLSK
  LIFNEHVAQWTLFSQLVNWFMFFCITRTLSNSLETVLTVAGLYYWFVAIESSKGISVISKQQATSYQSPQSRKMALLIAALACAIRPTSAITWLYVGLLD
  FIQIKFKCQFLFLEVIPLGAIVLAVTTFLDWWMHGSWVIVPLNFLKFNLFSSGGDYYGTHVFHWYFTQGFPSMIWTFLPFSVFGIIKSREWKLSGLIAWV
  LGVYSILGHKEFRFVLPVLPLALMFSGYCLAAMSQFKGKTPHRKRHFSRLQLSVIFLIITNVPMALYMSLLHQRGTEDVMFYLSKEAHDGRVKGVLFLMP
  CHSTPYYSTLH
Full Sequence
Protein Sequence     Length: 546     Download
MSHRRRSHAA VAPPPPEGDG GGSSPGKAGR IRPWPERRVL ALAMAFRAAN ALLVRTYFNP    60
DEHWQCLEVA HRIAFGYGHL TWEWKRGLRG YLHPLIFAAL YKFLAFLHLD TPWFMAMAPR    120
LLQSVFASFG DLYLYKLSKL IFNEHVAQWT LFSQLVNWFM FFCITRTLSN SLETVLTVAG    180
LYYWFVAIES SKGISVISKQ QATSYQSPQS RKMALLIAAL ACAIRPTSAI TWLYVGLLDF    240
IQIKFKCQFL FLEVIPLGAI VLAVTTFLDW WMHGSWVIVP LNFLKFNLFS SGGDYYGTHV    300
FHWYFTQGFP SMIWTFLPFS VFGIIKSREW KLSGLIAWVL GVYSILGHKE FRFVLPVLPL    360
ALMFSGYCLA AMSQFKGKTP HRKRHFSRLQ LSVIFLIITN VPMALYMSLL HQRGTEDVMF    420
YLSKEAHDGR VKGVLFLMPC HSTPYYSTLH SSLPMRFLDC TPSDNKGILD ESDRFLMNPL    480
DFVGEVFGNL SSFSHIVLFE SEERHVLELL SRNSFQEVRR FFHSHFKIDR ALQSSVAVYS    540
TMDVL*                                                               600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam11472DUF32060.00847050335+
pfam03901Glyco_transf_222.0e-9654450415+
PLN02816PLN02816054539499+
Gene Ontology
GO TermDescription
GO:0006506GPI anchor biosynthetic process
GO:0016757transferase activity, transferring glycosyl groups
GO:0031227intrinsic to endoplasmic reticulum membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACL52519.1015452550unknown [Zea mays]
GenBankACN32038.1015452550unknown [Zea mays]
DDBJBAG91273.1015191527unnamed protein product [Oryza sativa Japonica Group]
RefSeqNP_001043404.1015451553Os01g0580100 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001131169.1015452550hypothetical protein LOC100192477 [Zea mays]
Transmembrane Domains
StartEnd
87109
145164
171188
214236
249271
303325
330347
351370
391410
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO8453593461575020
GO8455582892625460
GO8818671532273790
GO8818671354125460
HO1427862243235460
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_016_00400.3Aquca_016_00400.1Aquca_016_00400.2
Arabidopsis lyrata861876
Arabidopsis thalianaAT5G14850.1AT5G14850.2
Brassica rapaBra023489
Carica papayaevm.model.supercontig_42.125
Capsella rubellaCarubv10000649m
Citrus clementinaCiclev10007971m
Citrus sinensisorange1.1g009445morange1.1g010488m
Cucumis sativusCucsa.351020.4Cucsa.351020.2Cucsa.351020.1Cucsa.351020.3
Eucalyptus grandisEucgr.C00228.1
Fragaria vescamrna04987.1-v1.0-hybrid
Glycine maxGlyma13g01500.1Glyma17g07620.2
Gossypium raimondiiGorai.010G092100.8Gorai.010G092100.1Gorai.010G092100.7Gorai.010G092100.6Gorai.010G092100.4
Gorai.010G092100.3Gorai.010G092100.2Gorai.010G092100.5
Linum usitatissimumLus10033341Lus10033296Lus10034759
Manihot esculentacassava4.1_005070m
Medicago truncatulaMedtr4g129500.1
Mimulus guttatusmgv1a004248m
Oryza sativaLOC_Os01g39810.4LOC_Os01g39810.3LOC_Os01g39810.2LOC_Os01g39810.1LOC_Os02g02110.1
Panicum virgatumPavirv00059707mPavirv00064501m
Physcomitrella patensPp1s32_143V6.1
Phaseolus vulgarisPhvul.003G151000.1
Picea abiesMA_10430738g0010
Populus trichocarpaPotri.018G098700.3Potri.018G098700.1Potri.018G098700.2
Prunus persicappa003843m
Ricinus communis30225.m001678
Setaria italicaSi016829m
Selaginella moellendorffii105923
Sorghum bicolorSb09g025250.1
Thellungiella halophilaThhalv10013155m
Vitis viniferaGSVIVT01023723001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny