y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi3g02700.1
FamilyGH16
Protein PropertiesLength: 337 Molecular Weight: 37662.6 Isoelectric Point: 8.5273
ChromosomeChromosome/Scaffold: 3 Start: 1622599 End: 1624110
Descriptionxyloglucan endotransglucosylase/hydrolase 30
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH16542154.9e-27
  SLLLDRTTGSGLVSSSMYHHGFFSASIKLPSDYTAGVIVAFYTSNGEVYEKTHDELDFEFLGNIRGKPWRVQTNVYGNGSVSRGREERYVLPFDPTTEFH
  RYSILWTRDAIIFYVDDVPIRYIPRSSYTVDDFPSKPMSLYATIWDGSNWATSGGRYRVDYI
Full Sequence
Protein Sequence     Length: 337     Download
MSPLIASAAL LLLLMLVAAA MADVTAATVA VSEGYTALFG FDNILRSADD RTVSLLLDRT    60
TGSGLVSSSM YHHGFFSASI KLPSDYTAGV IVAFYTSNGE VYEKTHDELD FEFLGNIRGK    120
PWRVQTNVYG NGSVSRGREE RYVLPFDPTT EFHRYSILWT RDAIIFYVDD VPIRYIPRSS    180
YTVDDFPSKP MSLYATIWDG SNWATSGGRY RVDYIHGPFV ASFTDLALVG CRASPAARTP    240
TDDGYCTEAE AALAASDPAV MTLAKQQAMR RFREQNMVYS YCYDTRRYPV PFPECDLVES    300
ERRRFKQSGH LRLAFRRRRR GRRPVRGVAG TAKADM*                             360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd02183GH16_fungal_CRH1_transglycosylase9.0e-2459221174+
cd00413Glyco_hydrolase_163.0e-2749215183+
PLN03161PLN031613.0e-4744295260+
pfam00722Glyco_hydro_163.0e-6633216184+
cd02176GH16_XET7.0e-11833295264+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005618cell wall
GO:0005975carbohydrate metabolic process
GO:0006073cellular glucan metabolic process
GO:0016762xyloglucan:xyloglucosyl transferase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACD03224.101932324326xyloglucan endotransglucosylase/hydrolase 14 [Actinidia deliciosa]
GenBankEAZ21594.102833632341hypothetical protein OsJ_05221 [Oryza sativa Japonica Group]
RefSeqNP_001045764.102831132315Os02g0127800 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001146328.102832332326hypothetical protein LOC100279904 [Zea mays]
RefSeqXP_002451458.102832341342hypothetical protein SORBIDRAFT_04g002290 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2uwc_B02829516271A Chain A, Crystal Structure Of Nasturtium Xyloglucan Hydrolase Isoform Nxg2
PDB2uwc_A02829516271A Chain A, Crystal Structure Of Nasturtium Xyloglucan Hydrolase Isoform Nxg2
PDB2vh9_B012951290A Chain A, Crystal Structure Of Nxg1-Deltayniig In Complex With Xllg, A Xyloglucan Derived Oligosaccharide
PDB2vh9_A012951290A Chain A, Crystal Structure Of Nxg1-Deltayniig In Complex With Xllg, A Xyloglucan Derived Oligosaccharide
PDB2uwa_C02829519274A Chain A, Crystal Structure Of The Nasturtium Seedling Xyloglucanase Isoform Nxg1
Transmembrane Domains
StartEnd
931
Signal Peptide
Cleavage Site
22
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EC962891282333140
HO778510282333140
EV242020280333110
CF515172259332910
DV537984200332320
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_005_00577.1Aquca_005_00577.2Aquca_062_00008.1Aquca_002_00238.1Aquca_030_00052.1
Arabidopsis lyrata484102471659858766473398471170
484893
Arabidopsis thalianaAT1G14720.1AT2G01850.1AT4G18990.1AT1G32170.1AT1G10550.1
AT3G44990.1
Brachypodium distachyonBradi1g68590.1Bradi4g29707.1Bradi3g52307.1Bradi1g01150.1Bradi1g27867.1
Bradi3g34227.1Bradi1g77990.1
Brassica rapaBra026630Bra024848Bra026809Bra013367Bra012559
Bra035513Bra018433Bra037614Bra019416Bra005238
Bra017220
Carica papayaevm.model.supercontig_2.137evm.model.supercontig_208.1evm.model.supercontig_1.14evm.model.supercontig_102.19
Capsella rubellaCarubv10017602mCarubv10009442mCarubv10006389mCarubv10009628mCarubv10009787m
Carubv10017750mCarubv10023595m
Citrus clementinaCiclev10001649mCiclev10015872mCiclev10032164mCiclev10028945mCiclev10012353m
Ciclev10024263m
Citrus sinensisorange1.1g018153morange1.1g021601morange1.1g019909morange1.1g021307morange1.1g022492m
orange1.1g020504morange1.1g036126m
Cucumis sativusCucsa.261710.1Cucsa.261710.2Cucsa.312820.1Cucsa.011980.1Cucsa.292650.1
Cucsa.285970.1Cucsa.385760.1Cucsa.306660.1
Eucalyptus grandisEucgr.B02660.1Eucgr.G02075.1Eucgr.D02229.1Eucgr.E00225.1Eucgr.B03348.1
Eucgr.J00383.1Eucgr.B03937.1Eucgr.A01661.1
Fragaria vescamrna13718.1-v1.0-hybridmrna00661.1-v1.0-hybridmrna09672.1-v1.0-hybrid
Glycine maxGlyma01g01770.1Glyma09g34140.1Glyma20g01520.1Glyma07g27990.1Glyma08g09940.1
Glyma05g26960.1Glyma18g18931.1Glyma11g19920.1Glyma12g08520.1Glyma13g39710.1
Glyma12g30200.1Glyma03g34170.1Glyma19g36870.1Glyma13g20450.1Glyma10g06140.1
Gossypium raimondiiGorai.005G153200.1Gorai.013G032000.1Gorai.004G182100.1Gorai.004G182100.4Gorai.008G223600.1
Gorai.009G414100.1Gorai.003G145700.1Gorai.006G162400.1Gorai.009G110900.1Gorai.004G231400.1
Gorai.007G373000.1
Linum usitatissimumLus10029000Lus10030760Lus10013240Lus10010427Lus10041341
Lus10029165Lus10013000Lus10037377Lus10021422Lus10016144
Lus10023009Lus10026535Lus10013822Lus10001396Lus10026536
Malus domesticaMDP0000139485MDP0000292695MDP0000311765MDP0000233177MDP0000208105
MDP0000180043MDP0000302385MDP0000209964
Manihot esculentacassava4.1_011563mcassava4.1_011497mcassava4.1_013982mcassava4.1_012162mcassava4.1_023740m
cassava4.1_013096mcassava4.1_012970mcassava4.1_013124mcassava4.1_013358m
Medicago truncatulaMedtr5g029100.1CU633465_13.1Medtr7g102260.1Medtr2g095800.1
Mimulus guttatusmgv1a019128mmgv1a023829mmgv1a008549mmgv1a011053mmgv1a009338m
mgv1a021958mmgv1a023121m
Oryza sativaLOC_Os10g02770.1LOC_Os03g13570.1LOC_Os09g23220.1LOC_Os02g03550.1LOC_Os03g63760.1
LOC_Os02g46910.1LOC_Os07g29750.1LOC_Os10g39840.1LOC_Os10g42670.1LOC_Os03g01800.1
LOC_Os02g57770.1
Panicum virgatumPavirv00032587mPavirv00052620mPavirv00046314mPavirv00050471mPavirv00029782m
Pavirv00064533mPavirv00064083mPavirv00016440mPavirv00017969mPavirv00066632m
Physcomitrella patensPp1s74_19V6.1Pp1s5_240V6.1
Phaseolus vulgarisPhvul.002G136200.1Phvul.003G014400.1Phvul.002G182000.1Phvul.003G052400.1Phvul.011G085200.1
Phvul.005G130900.1Phvul.007G148500.1Phvul.001G179900.1
Picea abiesMA_2873g0010MA_358917g0010MA_10429722g0010MA_12969g0010MA_306910g0010
MA_20669g0010MA_75919g0010MA_6179g0010MA_177431g0020MA_585083g0010
MA_10181547g0010MA_11511g0010
Populus trichocarpaPotri.001G136100.1Potri.010G102300.1Potri.008G138400.2Potri.008G138400.3Potri.008G138400.1
Potri.003G097300.1Potri.003G097300.2Potri.014G115000.1Potri.009G006600.1Potri.006G122900.1
Potri.016G098600.1
Prunus persicappa008275mppa007685mppa009090mppa007943mppa009437m
Ricinus communis30068.m00265729968.m00065929589.m00124627964.m00034930078.m002269
Setaria italicaSi036533mSi019429mSi030380mSi035702mSi030594m
Si039252mSi017659mSi036387mSi038925m
Selaginella moellendorffii11526656616232041
Sorghum bicolorSb01g041510.1Sb04g002290.1Sb02g024120.1Sb02g033240.1Sb04g031050.1
Sb01g000710.1Sb01g027960.1Sb01g030140.1Sb01g050070.1
Thellungiella halophilaThhalv10008160mThhalv10004560mThhalv10008109mThhalv10008234mThhalv10002627m
Vitis viniferaGSVIVT01013055001GSVIVT01011603001GSVIVT01020228001GSVIVT01031486001GSVIVT01033658001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)