y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi3g05130.1
FamilyGT65
Protein PropertiesLength: 442 Molecular Weight: 50011.9 Isoelectric Point: 8.9012
ChromosomeChromosome/Scaffold: 3 Start: 3573126 End: 3574923
DescriptionO-fucosyltransferase family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT65773860
  GLNNQKIAFARACLTAKYLNRSLLMPSLSASLFYKEVDLLQPITFDKVFDFNKFNARCHGFARLARYSEVSNHTEPFILQKGSGRRWTVERDLDQLQQSR
  LGVVDGSEVIHITGKHPFLWPDHWPVKDYARIFECLALAPEVETEVVKVISKIREAGRKARHEAAISHNKNKMDGLTDLPVQYIAVHMRIEKDWMIHCKK
  WEQRSNLNEICSSKGEIIHKVSQITDLRRPVVVYLAVADGLLEDDSVTSGWRVGMIAYEKKKLGVTTIYDRQPYLIKSAIDFEVCARADVFVGNSFSTFS
  NLVVLSRTEK
Full Sequence
Protein Sequence     Length: 442     Download
MNILQDLKHL KHISLPTRPV ICKCLIIVIG LIVLRAIVSP FLAINSSEKS FYESATLDLF    60
PGVRKDKFVE VPQIIWGLNN QKIAFARACL TAKYLNRSLL MPSLSASLFY KEVDLLQPIT    120
FDKVFDFNKF NARCHGFARL ARYSEVSNHT EPFILQKGSG RRWTVERDLD QLQQSRLGVV    180
DGSEVIHITG KHPFLWPDHW PVKDYARIFE CLALAPEVET EVVKVISKIR EAGRKARHEA    240
AISHNKNKMD GLTDLPVQYI AVHMRIEKDW MIHCKKWEQR SNLNEICSSK GEIIHKVSQI    300
TDLRRPVVVY LAVADGLLED DSVTSGWRVG MIAYEKKKLG VTTIYDRQPY LIKSAIDFEV    360
CARADVFVGN SFSTFSNLVV LSRTEKLYKL GKASSCGENV GLSSYAYNVI GDDGGPQRWM    420
TDMSDISLQR ISYGTNNISC H*                                             480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd11296O-FucT_like0.0026810235+
cd11299O-FucT_plant1.0e-1077380333+
cd11296O-FucT_like4.0e-21198384191+
pfam10250O-FucT4.0e-3277384344+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACN28408.1014411442unknown [Zea mays]
EMBLCAH40837.1014411441protein-O-fucosyltransferase 1 [Oryza sativa]
EMBLCAH40838.1014411441protein-O-fucosyltransferase 1 [Saccharum officinarum]
RefSeqNP_001046014.1014411441Os02g0168500 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002451612.1014411442hypothetical protein SORBIDRAFT_04g004590 [Sorghum bicolor]
Transmembrane Domains
StartEnd
2042
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO8579223061374420
GO86454730713060
GO8602822781654420
GO8573533071374420
GO8915372631494110
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_035_00086.1
Arabidopsis lyrata477820
Arabidopsis thalianaAT3G05320.1
Brassica rapaBra040646.99.283Bra040646.99.283
Capsella rubellaCarubv10013700mCarubv10013656m
Citrus clementinaCiclev10015216m
Citrus sinensisorange1.1g013043m
Cucumis sativusCucsa.236440.1
Eucalyptus grandisEucgr.H03600.1
Fragaria vescamrna20066.1-v1.0-hybrid
Glycine maxGlyma07g34965.1.189.378Glyma07g34965.1.189.378Glyma07g34965.2.189.378Glyma15g13250.1Glyma20g02800.2
Glyma20g02800.3Glyma09g02350.2Glyma07g34965.2.189.378Glyma09g02350.3Glyma07g34965.3.189.378
Glyma07g34965.3.189.378Glyma07g34965.1.70.189Glyma07g34965.1.70.189Glyma07g34965.2.70.189Glyma07g34965.2.70.189
Glyma07g34965.3.70.189Glyma07g34965.3.70.189
Gossypium raimondiiGorai.009G150500.1.203.398Gorai.011G050000.1Gorai.011G049800.1Gorai.010G169400.1Gorai.010G169400.2
Gorai.009G150500.1.84.201Gorai.009G150500.1.84.201Gorai.009G150500.1.203.398
Linum usitatissimumLus10018291Lus10040618
Malus domesticaMDP0000794968.202.395MDP0000218405.202.395MDP0000218405.202.395MDP0000794968.202.395MDP0000218405.83.200
MDP0000218405.83.200MDP0000794968.83.200MDP0000794968.83.200MDP0000292513
Manihot esculentacassava4.1_007711m
Medicago truncatulaMedtr4g083590.1Medtr2g028900.1
Mimulus guttatusmgv1a024556m.157.260mgv1a024556m.157.260mgv1a010727m
Oryza sativaLOC_Os02g07200.1LOC_Os02g07200.3LOC_Os02g07200.2
Panicum virgatumPavirv00064034mPavirv00047509m
Phaseolus vulgarisPhvul.006G131800.1.76.195Phvul.006G131600.2Phvul.006G131600.1Phvul.006G131800.1.76.195Phvul.006G131800.1.195.389
Phvul.006G131800.1.195.389
Picea abiesMA_458283g0010MA_730174g0010MA_10435476g0010
Populus trichocarpaPotri.015G117500.1Potri.012G118800.1
Prunus persicappa005601m
Ricinus communis30109.m000167
Setaria italicaSi020158m
Selaginella moellendorffii130392.157.337130392.157.337130392.42.158130392.42.158
Sorghum bicolorSb04g004590.1
Thellungiella halophilaThhalv10020752m.197.381Thhalv10020752m.197.381Thhalv10020752m.78.198Thhalv10020752m.78.198
Vitis viniferaGSVIVT01026258001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny