y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi3g09590.1
FamilyGH28
Protein PropertiesLength: 109 Molecular Weight: 12337 Isoelectric Point: 10.4268
ChromosomeChromosome/Scaffold: 3 Start: 7757332 End: 7758576
DescriptionPectin lyase-like superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH28281081.7e-22
  ELPGARYASFIHGNGLRDVVITGDKGVIDGQGDVWWNMWRRRTLQHTRPNLVEFVHSSGIHISNVVLKNSLFWNIHPVYSE
Full Sequence
Protein Sequence     Length: 109     Download
RGAVLKATQD TRSWLLMEPL PSYGRGRELP GARYASFIHG NGLRDVVITG DKGVIDGQGD    60
VWWNMWRRRT LQHTRPNLVE FVHSSGIHIS NVVLKNSLFW NIHPVYSE*                120
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00295Glyco_hydro_280.001379762+
COG5434PGU10.00042110896+
Gene Ontology
GO TermDescription
GO:0004650polygalacturonase activity
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACN33336.101108111218unknown [Zea mays]
GenBankACN36471.1011087114unknown [Zea mays]
GenBankEAY85246.101108104211hypothetical protein OsI_06620 [Oryza sativa Indica Group]
RefSeqNP_001046468.101108104211Os02g0256100 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002451891.101108106213hypothetical protein SORBIDRAFT_04g009310 [Sorghum bicolor]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CK05725510811080
CB65005610811080
CB64776410811080
CO51960010811080
EE18574110811080
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_003_00296.1Aquca_003_00639.3Aquca_003_00639.2Aquca_003_00639.1Aquca_003_00639.4
Aquca_014_00381.1Aquca_038_00086.1Aquca_037_00120.3Aquca_037_00120.2Aquca_037_00120.1
Aquca_038_00085.1Aquca_076_00048.1Aquca_020_00507.1
Arabidopsis lyrata486722906271492486866235486630
494984492520328395318449900877
477994493797472140905397906150
Arabidopsis thalianaAT3G62110.1AT4G23820.1AT3G48950.1AT3G61490.3AT3G61490.2
AT3G61490.1AT5G41870.1AT4G33440.1AT4G23500.1AT3G16850.1
AT5G49215.2AT5G49215.1AT2G23900.1AT3G06770.3AT3G06770.1
AT3G06770.2AT1G19170.1AT3G42950.1
Brachypodium distachyonBradi1g53430.2Bradi1g53430.1Bradi4g05050.1Bradi1g02720.2Bradi1g02720.1
Bradi2g43750.1Bradi1g52050.1Bradi4g11087.1Bradi1g76890.1Bradi3g13260.1
Bradi4g31250.1Bradi1g53430.3Bradi3g56787.1
Brassica rapaBra003485Bra007662Bra019264Bra013734Bra018023
Bra020656Bra007609Bra011440Bra019299Bra028511
Bra037005Bra013697Bra022182Bra037429Bra032138
Bra001642Bra001215Bra018004Bra016521Bra039462
Bra007626
Carica papayaevm.model.supercontig_107.107evm.model.supercontig_9.114evm.model.supercontig_29.51evm.model.supercontig_180.28evm.model.supercontig_57.18
evm.TU.contig_27928.2evm.model.supercontig_486.2evm.model.supercontig_151.35evm.model.supercontig_107.108evm.model.supercontig_28.9
Capsella rubellaCarubv10017170mCarubv10018803mCarubv10004811mCarubv10017147mCarubv10013686m
Carubv10026227mCarubv10004724mCarubv10004660mCarubv10024654mCarubv10004799m
Carubv10013668mCarubv10013478mCarubv10011469mCarubv10017105m
Citrus clementinaCiclev10020035mCiclev10004943mCiclev10004942mCiclev10019941mCiclev10019597m
Ciclev10004864mCiclev10003286mCiclev10020162mCiclev10008093m
Citrus sinensisorange1.1g012308morange1.1g012788morange1.1g011659morange1.1g009075morange1.1g011615m
orange1.1g013402morange1.1g020062morange1.1g020257morange1.1g023585morange1.1g021449m
orange1.1g038330morange1.1g036161morange1.1g038535morange1.1g036907m
Cucumis sativusCucsa.258550.1Cucsa.252790.1Cucsa.228510.1Cucsa.303830.1Cucsa.192980.1
Cucsa.141920.1
Eucalyptus grandisEucgr.K00562.2Eucgr.K00562.1Eucgr.D01821.1Eucgr.E00104.1Eucgr.E00105.1
Eucgr.D01730.1Eucgr.I00199.1Eucgr.A01315.1Eucgr.A02742.1Eucgr.E00853.1
Eucgr.A02740.1Eucgr.C00786.1
Fragaria vescamrna24477.1-v1.0-hybridmrna20022.1-v1.0-hybridmrna31826.1-v1.0-hybridmrna16186.1-v1.0-hybridmrna19241.1-v1.0-hybrid
mrna11093.1-v1.0-hybridmrna07072.1-v1.0-hybridmrna06153.1-v1.0-hybridmrna32082.1-v1.0-hybridmrna23300.1-v1.0-hybrid
mrna12538.1-v1.0-hybrid
Glycine maxGlyma19g40940.1Glyma10g27840.3Glyma10g27840.2Glyma03g38350.3Glyma03g38350.2
Glyma03g38350.1Glyma07g07280.1Glyma07g07290.2Glyma07g07290.1Glyma05g37490.1
Glyma02g01050.1Glyma08g02050.2Glyma08g02050.1Glyma07g37320.1Glyma07g37320.2
Glyma09g39200.1Glyma18g47130.1Glyma16g03680.2Glyma16g03680.1Glyma17g03300.1
Glyma15g15690.1Glyma09g04560.1Glyma08g41530.1Glyma18g14640.1Glyma10g37540.1
Glyma10g37530.1Glyma10g37540.2Glyma10g37540.3Glyma02g01910.1Glyma10g02030.1
Glyma14g03710.1Glyma03g37480.2Glyma03g37480.1Glyma19g40100.2Glyma06g15940.1
Glyma16g29780.1Glyma09g24470.1Glyma17g05550.1Glyma13g17170.1Glyma09g08270.1
Glyma15g19820.1Glyma14g03710.2Glyma10g02030.2Glyma02g45080.1Glyma20g30240.2
Glyma19g40100.3.92.249Glyma19g40100.3.92.249Glyma19g40100.3.251.383Glyma19g40100.3.251.383
Gossypium raimondiiGorai.008G134500.2Gorai.008G134500.1Gorai.004G147300.5Gorai.004G147300.4Gorai.004G147300.3
Gorai.004G147300.2Gorai.004G147300.1Gorai.006G077400.1Gorai.007G102200.2Gorai.007G102200.1
Gorai.001G158900.1Gorai.006G260100.3Gorai.006G260100.2Gorai.006G260100.1Gorai.011G194200.1
Gorai.012G035300.1Gorai.003G066600.1Gorai.003G155800.2Gorai.003G155800.1Gorai.008G274700.1
Gorai.004G138900.1Gorai.007G012900.1Gorai.007G026000.2Gorai.007G026000.1Gorai.004G134000.1
Gorai.012G035300.2Gorai.001G016500.1Gorai.009G036700.1Gorai.010G090400.1Gorai.007G026000.4
Gorai.004G134000.2Gorai.007G102200.4Gorai.007G102200.3Gorai.006G077400.2Gorai.006G077400.3
Gorai.009G036700.2Gorai.007G026000.3Gorai.004G134000.3Gorai.010G090400.2
Linum usitatissimumLus10038030Lus10007922Lus10032374Lus10028766Lus10017517
Lus10003589Lus10003890Lus10037714Lus10016837Lus10014799
Lus10023101Lus10039279Lus10027516Lus10027646Lus10039909
Lus10009972Lus10001899
Malus domesticaMDP0000130769MDP0000175027MDP0000137792MDP0000581832MDP0000610678
MDP0000202282MDP0000174216MDP0000147794MDP0000251956MDP0000254231
MDP0000225538MDP0000249285MDP0000249275MDP0000236768MDP0000321745
MDP0000766241MDP0000515489MDP0000128139MDP0000818931MDP0000665344
MDP0000269019MDP0000191981MDP0000292963MDP0000199345
Manihot esculentacassava4.1_026138mcassava4.1_007057mcassava4.1_007003mcassava4.1_023296mcassava4.1_007008m
cassava4.1_006215mcassava4.1_007421mcassava4.1_032219mcassava4.1_007592mcassava4.1_007544m
cassava4.1_033273mcassava4.1_026691mcassava4.1_026082mcassava4.1_008164mcassava4.1_006317m
cassava4.1_006279m
Medicago truncatulaMedtr7g110710.1Medtr4g120730.1Medtr7g088550.1Medtr7g038050.1Medtr7g078680.1
Medtr1g100050.1Medtr1g100060.1Medtr1g099850.1Medtr1g100040.1Medtr5g090160.1
Medtr3g096330.1Medtr1g086030.1Medtr2g042740.1Medtr4g124980.1Medtr2g083670.1
Mimulus guttatusmgv1a006147mmgv1a005694mmgv1a024920mmgv1a005601mmgv1a006062m
mgv1a023393mmgv1a006305mmgv1a005053mmgv1a004737mmgv1a005168m
Oryza sativaLOC_Os07g14160.1LOC_Os07g14160.4LOC_Os07g14160.3LOC_Os07g14160.2LOC_Os11g43750.1
LOC_Os03g61800.3LOC_Os03g61800.2LOC_Os03g61800.1LOC_Os05g50960.1LOC_Os12g36810.1
LOC_Os08g01600.1LOC_Os02g15690.1LOC_Os03g03350.1LOC_Os01g43160.1LOC_Os09g26800.1
LOC_Os02g54030.1
Panicum virgatumPavirv00030219mPavirv00058435mPavirv00018035mPavirv00034723mPavirv00048083m
Pavirv00017919mPavirv00069831mPavirv00004220mPavirv00021016mPavirv00014813m
Pavirv00063415mPavirv00050881mPavirv00038988mPavirv00052892mPavirv00056428m
Pavirv00042769mPavirv00017327mPavirv00038561mPavirv00048354mPavirv00014455m
Pavirv00035750mPavirv00054923m
Physcomitrella patensPp1s294_11V6.1Pp1s18_221V6.1Pp1s194_34V6.1Pp1s252_60V6.1Pp1s20_252V6.2
Pp1s60_185V6.1Pp1s20_252V6.1
Phaseolus vulgarisPhvul.001G218400.1Phvul.007G209200.1Phvul.002G292300.1Phvul.008G059700.1Phvul.007G165300.1
Phvul.009G252200.1Phvul.006G028800.1Phvul.008G199400.1Phvul.003G108700.1Phvul.004G047800.1
Phvul.007G217500.1Phvul.004G047700.1Phvul.004G108800.1Phvul.001G210300.2Phvul.001G210300.1
Phvul.009G151200.1Phvul.007G074300.1Phvul.003G129300.1Phvul.009G225400.1
Picea abiesMA_88519g0010MA_104339g0010MA_10430135g0020MA_10435166g0010MA_98717g0010
MA_6380g0020MA_11025g0010MA_345765g0010MA_9467735g0010MA_5735762g0010
MA_10436451g0020
Populus trichocarpaPotri.002G186900.2Potri.002G186900.1Potri.014G112100.1Potri.001G100000.1Potri.003G131700.1
Potri.010G005500.1Potri.010G008600.1Potri.008G211500.1Potri.002G162400.1Potri.007G105800.1
Potri.005G063400.1Potri.017G145900.1Potri.003G139100.1Potri.004G073900.1Potri.018G062700.2
Potri.006G139500.1Potri.018G062700.1Potri.006G139500.2Potri.002G162400.5Potri.002G162400.3
Potri.002G162400.2Potri.002G162400.4
Prunus persicappa005310mppa005599mppa005818mppa004996mppa005015m
ppa018224mppa006130mppa005185mppa020086mppa018901m
ppa004793m
Ricinus communis56826.m00002730190.m01126429726.m00410530169.m00662330174.m008646
30137.m00044030190.m01082329739.m00372830169.m006622.88.25030169.m006622.88.250
30169.m006622.270.40630169.m006622.270.40633029.m00002237576.m00002039176.m000013
Setaria italicaSi032032mSi035484mSi026354mSi006319mSi006318m
Si001461mSi035616mSi013629mSi022052mSi017201m
Si029141mSi016984m
Selaginella moellendorffii12401133152785567493499190
Sorghum bicolorSb02g007470.1Sb01g002550.1Sb10g000660.1Sb07g000740.1Sb03g028140.1
Sb04g009310.1Sb01g048880.1Sb09g030140.1Sb05g025980.1Sb02g025730.1
Sb04g035020.1
Thellungiella halophilaThhalv10005947mThhalv10005946mThhalv10005945mThhalv10005958mThhalv10025189m
Thhalv10005939mThhalv10025100mThhalv10025011mThhalv10004215mThhalv10020710m
Thhalv10020733mThhalv10000145mThhalv10027766mThhalv10027765mThhalv10010343m
Thhalv10007407mThhalv10002498mThhalv10011050m.73.238Thhalv10011050m.73.238Thhalv10011050m.276.426
Thhalv10011050m.276.426
Vitis viniferaGSVIVT01028246001GSVIVT01035089001GSVIVT01028057001GSVIVT01019516001GSVIVT01026477001
GSVIVT01015044001GSVIVT01019405001GSVIVT01028861001GSVIVT01026985001GSVIVT01028860001.80.271
GSVIVT01028860001.80.271GSVIVT01028860001.331.546GSVIVT01028860001.331.546
Zea maysAC231180.2_FGT006
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)