y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi3g10470.1
FamilyAA2
Protein PropertiesLength: 323 Molecular Weight: 34596.6 Isoelectric Point: 8.9103
ChromosomeChromosome/Scaffold: 3 Start: 8652820 End: 8654196
DescriptionPeroxidase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA2492047.69999e-40
  RFARDPKIVAFLLRLLFHECGVNGCDGGLLIDGFGTEKTALPNLSVNGYDLIAEIKTELERRCPRVVSCSDIEILATRDAVALAGGAKYLVRTGRRDGRQ
  SRASDVNLPAPNSTVAQATSFFGRLGLSQFDMALLLGAHTVGVTHCGVIKGRLYSH
Full Sequence
Protein Sequence     Length: 323     Download
MASAVLLVVA LAVLGLATGG DAQLQNGFYR GKCGSNDVEA IVQGVVRARF ARDPKIVAFL    60
LRLLFHECGV NGCDGGLLID GFGTEKTALP NLSVNGYDLI AEIKTELERR CPRVVSCSDI    120
EILATRDAVA LAGGAKYLVR TGRRDGRQSR ASDVNLPAPN STVAQATSFF GRLGLSQFDM    180
ALLLGAHTVG VTHCGVIKGR LYSHGGKAGA TDPSLDPSLA SVFKKFVCPN TPSSDNNIVF    240
LDDQPSALRV DNGYYKMLQR RRGVLSVDQN LYGDGSTRWI VDMLANTDNF RAFFPQALVK    300
LGEVKVLTGA QGEIRRVCNR FN*                                            360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00314plant_peroxidase_like1.0e-1442303298+
pfam00141peroxidase5.0e-5642189150+
PLN03030PLN030306.0e-7527322302+
cd00693secretory_peroxidase2.0e-13623321304+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEAZ08613.102232227328hypothetical protein OsI_30884 [Oryza sativa Indica Group]
RefSeqNP_001062872.102232227328Os09g0323700 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001062873.102232228331Os09g0323900 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002464909.102232228330hypothetical protein SORBIDRAFT_01g028640 [Sorghum bicolor]
RefSeqXP_002467467.102332230331hypothetical protein SORBIDRAFT_01g028610 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1qo4_A0233222304B Chain B, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector
PDB1pa2_A0233222304A Chain A, Arabidopsis Thaliana Peroxidase A2
PDB3hdl_A0243222303A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree
PDB4a5g_B0283228305A Chain A, Raphanus Sativus Anionic Peroxidase.
PDB4a5g_A0283228305A Chain A, Raphanus Sativus Anionic Peroxidase.
Metabolic Pathways
Pathway NameReactionECProtein Name
betanidin degradationRXN-8635EC-1.11.1.7peroxidase
Signal Peptide
Cleavage Site
22
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CJ808469206182220
BI305990182242040
CB967487169301980
FL870947269563230
DR057895267242850
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_028_00270.1
Arabidopsis lyrata488648489264483456913963354185
477612489097
Arabidopsis thalianaAT5G22410.1AT5G17820.1AT2G43480.1AT5G24070.1AT3G03670.1
AT4G26010.1AT1G34510.1
Brachypodium distachyonBradi3g33780.1Bradi3g10460.1
Brassica rapaBra006423Bra023639Bra036445Bra037713Bra009728
Bra026470Bra019132Bra013943Bra001084Bra019131
Bra020191
Carica papayaevm.model.supercontig_161.43evm.model.supercontig_1040.1evm.model.supercontig_13.208evm.model.supercontig_195.9
Capsella rubellaCarubv10003382mCarubv10003258mCarubv10024496mCarubv10003419mCarubv10006454m
Carubv10006236mCarubv10016138m
Citrus clementinaCiclev10024589mCiclev10024189mCiclev10023906mCiclev10030190m
Citrus sinensisorange1.1g043363morange1.1g045265morange1.1g040171m
Cucumis sativusCucsa.362070.1Cucsa.319800.1
Eucalyptus grandisEucgr.A02147.1Eucgr.J00503.1Eucgr.B03840.1Eucgr.B03838.1Eucgr.A00301.1
Eucgr.A00298.1Eucgr.A00295.1Eucgr.A00045.1Eucgr.A00299.2Eucgr.A00299.1
Eucgr.A00042.1Eucgr.A02146.1Eucgr.D00818.1Eucgr.A00296.1
Fragaria vescamrna26378.1-v1.0-hybridmrna07700.1-v1.0-hybridmrna21725.1-v1.0-hybrid
Glycine maxGlyma03g01020.1Glyma03g01010.1Glyma13g42140.1Glyma15g03250.1Glyma19g16960.1
Gossypium raimondiiGorai.004G252800.1Gorai.009G084400.1Gorai.007G253300.1Gorai.005G126200.1
Linum usitatissimumLus10004859Lus10005679Lus10032511Lus10020312Lus10022962
Lus10004804Lus10025586Lus10013631Lus10001324Lus10005681
Lus10043010Lus10018375Lus10020311
Malus domesticaMDP0000269302MDP0000264903MDP0000243237MDP0000156208
Manihot esculentacassava4.1_024710mcassava4.1_028102mcassava4.1_031145mcassava4.1_022946m
Medicago truncatulaMedtr7g086820.1Medtr7g086870.1
Mimulus guttatusmgv1a010343mmgv1a024318mmgv1a022139m
Oryza sativaLOC_Os03g05770.1LOC_Os04g01550.1LOC_Os10g41720.1LOC_Os09g15510.1LOC_Os09g15500.1
Panicum virgatumPavirv00070122mPavirv00055443mPavirv00050601mPavirv00048315mPavirv00056057m
Pavirv00026792mPavirv00052815mPavirv00005617mPavirv00066198mPavirv00005755m
Pavirv00010656mPavirv00020133m
Physcomitrella patensPp1s112_99V6.1Pp1s35_32V6.1Pp1s12_174V6.1
Phaseolus vulgarisPhvul.005G154900.1Phvul.004G053800.1Phvul.001G106500.1Phvul.001G106600.1
Picea abiesMA_257706g0010MA_10426168g0010.52.319MA_10426168g0010.52.319MA_180710g0010MA_10293471g0010
MA_10428075g0010MA_63239g0010MA_10372670g0010MA_10426168g0010.347.524MA_10426168g0010.347.524
Populus trichocarpaPotri.001G218500.1Potri.001G218600.1Potri.013G066800.1Potri.015G110200.1Potri.007G132800.1
Prunus persicappa023274mppa026551mppa009513m
Ricinus communis30072.m00092829272.m00004330147.m014371
Setaria italicaSi011748mSi036621mSi036586mSi036567mSi038861m
Si039188m
Selaginella moellendorffii416327
Sorghum bicolorSb06g000490.1Sb01g046800.1Sb01g028640.1Sb01g016620.1Sb01g028610.1
Thellungiella halophilaThhalv10015253mThhalv10014171mThhalv10004528mThhalv10001541mThhalv10025781m
Thhalv10021155mThhalv10026803m
Vitis viniferaGSVIVT01004097001GSVIVT01036100001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)