y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi3g13487.1
FamilyGH116
Protein PropertiesLength: 914 Molecular Weight: 100654 Isoelectric Point: 6.0867
ChromosomeChromosome/Scaffold: 3 Start: 11929207 End: 11934060
DescriptionBeta-glucosidase, GBA2 type family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1164898490
  GQFLYLEATEYYMYNTYDVHFYASFALLSLFPELELSLQRDFARAVLIHDPRPMVTLDGATVLRKVLGAVPHDIGLNDPWFELNAYMIHDPARWKDLNPK
  FVLQVYRAVVVTGNAAFAKAAWPAVYLAMAYMDQYDRDGDGMVENEGPDQTYDLWSVTGVSAYTGGIWVTALQATAAMARIVGDGDAECYFHGRYLRAKQ
  VYDAELWNGTYFRYDNSGGETSESIMADQLAGQWYAHVCGLEPVVEEDKARSALATVLDYNVMRVKGGAVGAVNGMRPDGGIDMSSTQSKEIWSGTTYAV
  AAAMVHEGMPEGAFRTAKGAHDASWGKAGFGYAFQTPEAWTAEGGYRGLHYMRPLSVWAMQ
Full Sequence
Protein Sequence     Length: 914     Download
MGSLKLEQTK AHSLIDCAQP ATRTWQRKFD DEGKKIEMFS MTMNDMILID VIYDPFKKWM    60
DNCYRGLPLG GLGAGSIGRS YRGYFQHFQI FPAIYEQKPI LANQFSAFIS RPNGKSYSTV    120
LSAPTADVLK GVDKAGIGSW DWKLKEKNCT YHALFPRSWT VYDGEPDPAI KITCRQISPF    180
IPHNYKESSF PVVVFTFTVH NTGSTPADVT LLFTWANSVG GRSELTGNHT NSKMMERDGV    240
HGVLLHHRTA NDGHPPVTFA IASQETEDVR VTDCPSFTMG SSSSGDFTAK DMWQEIKKHG    300
SFITTDKEPR ASKPGSSIGA AVAAATTVPA GGTRVVSFAL SWSCPEVKFP AGRTYHRRYT    360
TFHGLDRDAA AESLAHDALL EHMDWESKIE EWQRPILQDK RLPDWYPVAL FNELYYLNAG    420
GTIWTDGLPP KMSVSSSGVG TEPFSLATTY LPGTAVDGIL SAVASATEDQ HSAAAFGATL    480
LGDGEENVGQ FLYLEATEYY MYNTYDVHFY ASFALLSLFP ELELSLQRDF ARAVLIHDPR    540
PMVTLDGATV LRKVLGAVPH DIGLNDPWFE LNAYMIHDPA RWKDLNPKFV LQVYRAVVVT    600
GNAAFAKAAW PAVYLAMAYM DQYDRDGDGM VENEGPDQTY DLWSVTGVSA YTGGIWVTAL    660
QATAAMARIV GDGDAECYFH GRYLRAKQVY DAELWNGTYF RYDNSGGETS ESIMADQLAG    720
QWYAHVCGLE PVVEEDKARS ALATVLDYNV MRVKGGAVGA VNGMRPDGGI DMSSTQSKEI    780
WSGTTYAVAA AMVHEGMPEG AFRTAKGAHD ASWGKAGFGY AFQTPEAWTA EGGYRGLHYM    840
RPLSVWAMQW ALSPPELHKD LGLASVSPPG DAARGREKFD KVAGMLRLPE KVQHKGFFLA    900
LYHSLRQLVL PAC*                                                      960
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG4354COG43541.0e-2561426384+
pfam12215GBA2_N3.0e-5766385329+
COG4354COG43546.0e-68488852385+
pfam04685DUF6081.0e-154489850367+
Gene Ontology
GO TermDescription
GO:0004348glucosylceramidase activity
GO:0006665sphingolipid metabolic process
GO:0016021integral to membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEEE67921.1019121919hypothetical protein OsJ_25789 [Oryza sativa Japonica Group]
RefSeqNP_001060825.1019121928Os08g0111200 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002325943.105190222882predicted protein [Populus trichocarpa]
RefSeqXP_002444904.1019111928hypothetical protein SORBIDRAFT_07g001140 [Sorghum bicolor]
RefSeqXP_002528846.101590325943conserved hypothetical protein [Ricinus communis]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EE0245112895538390
DR8068182895538390
FF3449812635277880
FF3467772535377880
EC9041982795638390
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00087.2Aquca_017_00087.1Aquca_034_00116.1
Arabidopsis lyrata331392479911473529327181
Arabidopsis thalianaAT1G33700.2AT1G33700.1AT5G49900.1AT3G24180.2AT3G24180.1
AT4G10060.1
Brachypodium distachyonBradi3g28580.1Bradi4g21277.1Bradi1g28847.1Bradi3g13520.1
Brassica rapaBra014964Bra028008Bra000598Bra028320Bra033199
Carica papayaevm.model.supercontig_59.121evm.model.supercontig_21.79evm.model.supercontig_113.12
Capsella rubellaCarubv10025826mCarubv10012912mCarubv10008221mCarubv10002637m
Citrus clementinaCiclev10004255mCiclev10000199mCiclev10018743mCiclev10018742m
Citrus sinensisorange1.1g039165morange1.1g002202morange1.1g038924m
Cucumis sativusCucsa.266300.2Cucsa.266300.1Cucsa.023010.1Cucsa.237200.1Cucsa.237200.2
Eucalyptus grandisEucgr.I02786.1Eucgr.H02851.2Eucgr.H02851.1Eucgr.H00075.1Eucgr.F02980.1
Eucgr.F02980.2
Fragaria vescamrna29905.1-v1.0-hybridmrna02278.1-v1.0-hybrid
Glycine maxGlyma10g33610.1Glyma20g33990.1Glyma07g40310.2
Gossypium raimondiiGorai.008G046700.1Gorai.011G160300.5Gorai.011G160300.4Gorai.011G160300.3Gorai.011G160300.2
Gorai.011G160300.1Gorai.013G133800.2Gorai.013G133800.1Gorai.006G221200.3Gorai.006G221200.2
Gorai.006G221200.1Gorai.008G046700.3Gorai.008G046700.2.531.722Gorai.008G046700.2.531.722Gorai.008G046700.2.724.851
Gorai.008G046700.2.724.851
Linum usitatissimumLus10000757Lus10003517Lus10002950Lus10023340Lus10038471
Lus10038469
Malus domesticaMDP0000175141MDP0000220028MDP0000128604
Manihot esculentacassava4.1_001108mcassava4.1_002224mcassava4.1_003299mcassava4.1_005809m
Medicago truncatulaMedtr1g072720.1Medtr1g072680.1
Mimulus guttatusmgv1a000876mmgv1a000873m
Oryza sativaLOC_Os10g33420.1LOC_Os11g13810.1LOC_Os08g01940.2LOC_Os08g01940.1LOC_Os07g26210.1
LOC_Os07g26210.2
Panicum virgatumPavirv00047844mPavirv00042892mPavirv00041095mPavirv00002207mPavirv00050055m
Pavirv00014420mPavirv00035631mPavirv00038108m
Physcomitrella patensPp1s134_55V6.1Pp1s40_202V6.1
Phaseolus vulgarisPhvul.007G134300.1Phvul.003G075400.1
Picea abiesMA_10430605g0020MA_10431145g0020MA_61180g0010MA_35878g0010MA_10426003g0020.110.198
MA_10426003g0020.110.198MA_165077g0010
Populus trichocarpaPotri.T163400.1Potri.019G072800.2Potri.019G072800.1Potri.004G227200.4Potri.004G227200.2
Potri.004G227200.1Potri.003G178000.4Potri.003G178000.3Potri.003G178000.2Potri.003G178000.1
Potri.003G003400.1Potri.003G003400.2Potri.019G072800.3Potri.004G227200.3Potri.003G003400.3
Prunus persicappa001012mppa000954m
Ricinus communis29685.m00048429757.m00075229904.m002967
Setaria italicaSi034088mSi026057mSi025923mSi029270mSi028945m
Si028854mSi013210mSi026013m
Selaginella moellendorffii16663492385
Sorghum bicolorSb01g019510.2Sb01g019510.1Sb05g007160.1Sb0073s002050.1Sb07g001140.1
Thellungiella halophilaThhalv10006714mThhalv10012588mThhalv10020003mThhalv10020001m
Vitis viniferaGSVIVT01036381001GSVIVT01023217001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)