y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi3g13520.1
FamilyGH116
Protein PropertiesLength: 947 Molecular Weight: 104373 Isoelectric Point: 6.2235
ChromosomeChromosome/Scaffold: 3 Start: 12061886 End: 12066925
DescriptionBeta-glucosidase, GBA2 type family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1165098750
  GKFLYLEGMEYHMYNTYDVHFYASFALLSLFPDLELSLQRDFAAAVLRHDPRLMYTLDGKFVPRKVLGAVPHDIGLNDPWHELNAYMIHDPSRWKDLNPK
  FVLQVYRDVAATGDLDFARSAWPSVYVALAYMDQFDRDRDGMVENEGRPDQTYDLWSVSGVSAYTGGLWVAALRAATAMAALVGDLPAEAVFLERYNRAN
  KVYDSELWTGDYFRYDNSGGGNSESVMADQLAGQWYARACGLEPVVGRDKARRALAAVLEHNVMQVQGGGVGAVNGARLPEHGGGVDESSTQSKEVWTGT
  TYAVAAAMIGEGMREEGFTAAKGAYGAGWGEDGYGYAFQMPESWTADGAGGYRSLHYMRPLAVWAMQ
Full Sequence
Protein Sequence     Length: 947     Download
MGSSELEQTK AHSHIDCAQP PERTWQRKFD DEGKEIAMFS FTMNDIMTVA PLIVKMMRIL    60
VEERAKGKAS VYDPFKKWMS NCYRGVPLGT LGAGSIGRSY RGYFQHFQLF PGIYEQKPIL    120
ANQFSAFVSR PGGKSYSTVL SAPPAEVLKG IDKASIGSWD WNLKEKNCSY HGLFPRSWTV    180
YDGEPDPEIK ITCRQISPFI PRNYKESSFP VAVFTFTVQN SGSTPADVTL LFTWANSVGG    240
KSELTGNHSN STMRARDGVH GVLLRHSTAE GHPPVTFAIA SQDTGDVRVT CCPSFSMGPS    300
SKSGEPTAKE MWEEIKKHGS FGDAAAGTGR PSRPGSSVGA AVAAATTVTA GCTREVSFAL    360
SWSCPVVKFP AGRTYHRRHT KFVGLDRDAA AEQLAHHALL EHMEWERQIE AWQRPVLQDK    420
SLPDWYPVAL FNELYYLNAG GTIWTDGMPS KKTSLVSSSS GTMEPFSLAA FHPDPNATSS    480
STAADDILLA MARAEEHLLP AAEDEKGVGK FLYLEGMEYH MYNTYDVHFY ASFALLSLFP    540
DLELSLQRDF AAAVLRHDPR LMYTLDGKFV PRKVLGAVPH DIGLNDPWHE LNAYMIHDPS    600
RWKDLNPKFV LQVYRDVAAT GDLDFARSAW PSVYVALAYM DQFDRDRDGM VENEGRPDQT    660
YDLWSVSGVS AYTGGLWVAA LRAATAMAAL VGDLPAEAVF LERYNRANKV YDSELWTGDY    720
FRYDNSGGGN SESVMADQLA GQWYARACGL EPVVGRDKAR RALAAVLEHN VMQVQGGGVG    780
AVNGARLPEH GGGVDESSTQ SKEVWTGTTY AVAAAMIGEG MREEGFTAAK GAYGAGWGED    840
GYGYAFQMPE SWTADGAGGY RSLHYMRPLA VWAMQWALSP PTPVLPELER MAAKSKATEE    900
EVELAKEKFE KVASLLRLPE EEKKKEKGYL RAFYQILRQI LLPAAY*                  960
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG4354COG43541.0e-2685446379+
pfam12215GBA2_N1.0e-5285388314+
COG4354COG43541.0e-61508878387+
pfam04685DUF6081.0e-131509876372+
Gene Ontology
GO TermDescription
GO:0004348glucosylceramidase activity
GO:0006665sphingolipid metabolic process
GO:0016021integral to membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEEE67921.1019441919hypothetical protein OsJ_25789 [Oryza sativa Japonica Group]
RefSeqNP_001060825.1019441928Os08g0111200 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002444904.1019431928hypothetical protein SORBIDRAFT_07g001140 [Sorghum bicolor]
RefSeqXP_002450573.101993933947hypothetical protein SORBIDRAFT_05g007160 [Sorghum bicolor]
RefSeqXP_002528846.101592325933conserved hypothetical protein [Ricinus communis]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EG37648628012800
DV48513220112010
EE0245112945738650
DR8068182945738650
CA26930422812280
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00087.2Aquca_017_00087.1Aquca_034_00116.1
Arabidopsis lyrata331392479911473529327181
Arabidopsis thalianaAT1G33700.2AT1G33700.1AT5G49900.1AT3G24180.2AT3G24180.1
AT4G10060.1
Brachypodium distachyonBradi3g28580.1Bradi4g21277.1Bradi3g13487.1Bradi1g28847.1
Brassica rapaBra014964Bra028008Bra000598Bra028320Bra033199
Carica papayaevm.model.supercontig_59.121evm.model.supercontig_21.79evm.model.supercontig_113.12
Capsella rubellaCarubv10025826mCarubv10012912mCarubv10008221mCarubv10002637m
Citrus clementinaCiclev10004255mCiclev10000199mCiclev10018743mCiclev10018742m
Citrus sinensisorange1.1g039165morange1.1g002202morange1.1g038924m
Cucumis sativusCucsa.266300.2Cucsa.266300.1Cucsa.023010.1Cucsa.237200.1Cucsa.237200.2
Eucalyptus grandisEucgr.I02786.1Eucgr.H02851.2Eucgr.H02851.1Eucgr.H00075.1Eucgr.F02980.1
Eucgr.F02980.2
Fragaria vescamrna29905.1-v1.0-hybridmrna02278.1-v1.0-hybrid
Glycine maxGlyma10g33610.1Glyma20g33990.1Glyma07g40310.2
Gossypium raimondiiGorai.008G046700.1Gorai.011G160300.5Gorai.011G160300.4Gorai.011G160300.3Gorai.011G160300.2
Gorai.011G160300.1Gorai.013G133800.2Gorai.013G133800.1Gorai.006G221200.3Gorai.006G221200.2
Gorai.006G221200.1Gorai.008G046700.3Gorai.008G046700.2.531.722Gorai.008G046700.2.531.722Gorai.008G046700.2.724.851
Gorai.008G046700.2.724.851
Linum usitatissimumLus10000757Lus10003517Lus10002950Lus10023340Lus10038471
Lus10038469
Malus domesticaMDP0000175141MDP0000220028MDP0000128604
Manihot esculentacassava4.1_001108mcassava4.1_002224mcassava4.1_003299mcassava4.1_005809m
Medicago truncatulaMedtr1g072720.1Medtr1g072680.1
Mimulus guttatusmgv1a000876mmgv1a000873m
Oryza sativaLOC_Os10g33420.1LOC_Os11g13810.1LOC_Os08g01940.2LOC_Os08g01940.1LOC_Os07g26210.1
LOC_Os07g26210.2
Panicum virgatumPavirv00047844mPavirv00042892mPavirv00041095mPavirv00002207mPavirv00050055m
Pavirv00014420mPavirv00035631mPavirv00038108m
Physcomitrella patensPp1s134_55V6.1Pp1s40_202V6.1
Phaseolus vulgarisPhvul.007G134300.1Phvul.003G075400.1
Picea abiesMA_10430605g0020MA_10431145g0020MA_61180g0010MA_35878g0010MA_10426003g0020.110.198
MA_10426003g0020.110.198MA_165077g0010
Populus trichocarpaPotri.T163400.1Potri.019G072800.2Potri.019G072800.1Potri.004G227200.4Potri.004G227200.2
Potri.004G227200.1Potri.003G178000.4Potri.003G178000.3Potri.003G178000.2Potri.003G178000.1
Potri.003G003400.1Potri.003G003400.2Potri.019G072800.3Potri.004G227200.3Potri.003G003400.3
Prunus persicappa001012mppa000954m
Ricinus communis29685.m00048429757.m00075229904.m002967
Setaria italicaSi034088mSi026057mSi025923mSi029270mSi028945m
Si028854mSi013210mSi026013m
Selaginella moellendorffii16663492385
Sorghum bicolorSb01g019510.2Sb01g019510.1Sb05g007160.1Sb0073s002050.1Sb07g001140.1
Thellungiella halophilaThhalv10006714mThhalv10012588mThhalv10020003mThhalv10020001m
Vitis viniferaGSVIVT01036381001GSVIVT01023217001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)