y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi3g14080.1
FamilyGT92
Protein PropertiesLength: 586 Molecular Weight: 65087.3 Isoelectric Point: 9.9925
ChromosomeChromosome/Scaffold: 3 Start: 12508599 End: 12511269
Descriptionzinc finger (C3HC4-type RING finger) family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT923155173e-21
  HSMCVCTMLRNQARFLREWIMYHSHVGVQRWFIYDNNSDDDIEQVLNTMDPARYNVTRYLWPWMKSQEAGFAHCALRARESCEWVGFIDIDEFLHFPGNQ
  TLQAVLRNYSSRPQIGELRTSCHSFGPSGRTKIPRKGVTTGYTCRLAAPERHKSIVRPDALNPSLINVVHHFHLKEGIKYANIGQGVMLINHYKYQVWEV
  FKD
Full Sequence
Protein Sequence     Length: 586     Download
MAMSAKERKL SRLGSGKGPS GARGGGQQRT PPAGSRRRLF AAFFAFLCAG AVLLGGAHVI    60
GASFRPVLLT AWPSATLNAV SSERGAQQAG SGGAVLPSVQ VRHAVALPDH VLLILRDDGS    120
LLLASRQFEC LYSVANSTQL RQLPLSVASL PGGPNLVHCP AGPAGAAVSL SLSEWPPVVP    180
LEWDRLAYTA LIDSRDNSTV VFAKGMNLRP GRLGVPSRYE CVFGRDLSKP KFVVTSPVVS    240
AAQETFRCVT PARIRRYLRM TSDDYGASNC GDKPMLVSVR TKGRGSSTLP SIAHPEPLPR    300
YNRHRRNRHR QRKAHSMCVC TMLRNQARFL REWIMYHSHV GVQRWFIYDN NSDDDIEQVL    360
NTMDPARYNV TRYLWPWMKS QEAGFAHCAL RARESCEWVG FIDIDEFLHF PGNQTLQAVL    420
RNYSSRPQIG ELRTSCHSFG PSGRTKIPRK GVTTGYTCRL AAPERHKSIV RPDALNPSLI    480
NVVHHFHLKE GIKYANIGQG VMLINHYKYQ VWEVFKDKFS GRVATYVADW QDEENVGSRD    540
RAPGLGTKPV EPEDWPSRFC EVYDTGLKDF VHKEFTDPQT GNLPW*                   600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam13704Glyco_tranf_2_45.0e-1232442099+
pfam01697Glyco_transf_924.0e-38313518240+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACN34109.1015851598unknown [Zea mays]
DDBJBAD10590.10915853491zinc finger (C3HC4-type RING finger) protein family-like [Oryza sativa Japonica Group]
GenBankEEC82835.1015851584hypothetical protein OsI_27644 [Oryza sativa Indica Group]
RefSeqNP_001060883.1015851584Os08g0121900 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002444971.1015851588hypothetical protein SORBIDRAFT_07g002140 [Sorghum bicolor]
Transmembrane Domains
StartEnd
3961
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO8657763252625860
DR8084582753135860
DT9488602563135670
FF3507632343535860
FL7552002363515860
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_025_00172.1Aquca_002_00375.1
Arabidopsis lyrata493908484521
Arabidopsis thalianaAT5G40720.1
Brassica rapaBra028472Bra025268
Carica papayaevm.model.supercontig_5.316
Citrus clementinaCiclev10030976m
Citrus sinensisorange1.1g043544morange1.1g037991m
Cucumis sativusCucsa.136130.1
Eucalyptus grandisEucgr.B03384.1
Glycine maxGlyma02g03040.1Glyma01g04515.1Glyma08g40440.1
Gossypium raimondiiGorai.009G345800.1Gorai.006G037600.1
Manihot esculentacassava4.1_034265mcassava4.1_007462m
Mimulus guttatusmgv1a001120mmgv1a003136m
Panicum virgatumPavirv00056779m
Phaseolus vulgarisPhvul.008G147000.1Phvul.002G078300.1
Ricinus communis29736.m002092
Selaginella moellendorffii102746
Sorghum bicolorSb07g002140.1
Vitis viniferaGSVIVT01003965001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny