y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi3g15027.1
FamilyCBM53
Protein PropertiesLength: 1718 Molecular Weight: 191453 Isoelectric Point: 4.62
ChromosomeChromosome/Scaffold: 3 Start: 13304489 End: 13316066
Descriptionstarch synthase 3
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM538359189.7e-30
  SVIDLYLNRDLTALASEPDVVIKGAFNGWKWRLFTERLNKSDLGGVWWSCKLYIPKEAYRLDFVFFNGRSVYENNGNNDFFIEI
CBM53117112593.8e-33
  GTTVEIIYNPSNTVLNGKPEVWFRGSFNLWMHPSGALPPQKMVKVQDGSLLKATVSVPPDAYMLDFVFSESEDGGIYDNRNGMDYHIPV
CBM53100910977.2e-34
  GDTVRLYYNRNSRPLMYSTEIWMHGGYNNWTDGLSIVERLVKCNDKNGDWWHADVILPEKALVLDWVLADGPPGNARTYDNNGRQDFHA
GT5127017120
  HIVHIAVEMAPIAKVGGLGDVVTSLSRAVQDLGHTVEVILPKYDCLKQSSVKNLHLYTSFSWGGTEIKVWTGLVEDLLVYFLEPQNGMFEVGCVYGRNDD
  RRFGFFCHSALEFLLQNGSSPHIIHCHDWSSAPVAWIYKEHYAQSRLASARVVFTIHNLEFGAQYISKAMAYCDKATTVSHTYSREVTGHGAIAPHREKF
  YGILNGIDQDIWDPYTDDFLPVSYTSENVVEGKSAAKRALQQKFGLQQTDVPIVGIITRLTPQKGIHLIKHAIHRTLESNGQVVLLGSAPDPRIQGDFCR
  LADSLHGVYHGRVKLALTYDEPLSRLIYAGSDFILVPSIFEPCGLTQLVAMRYGSVPIVRKTGGLYDTVFDVDNDRERARSLGLEPNGFSFNGADSNGVD
  YALNRAIAAWFDARDWFHSLCKRVMEQDWSWNRPALDYIELYH
Full Sequence
Protein Sequence     Length: 1718     Download
MAMALRPQSP LCPRSRQQPL VVRPAGGAGL PQLFLYMMRA LLILYESVFG CQQTFISDQQ    60
IYSKQDCSMH GNKFSLCLSK LGHADSPNRK SRRTISPHVE VISSRGYTPR LTVELSTKKR    120
EDEETVGTYN RLFSTDATEW TGSREAGTAE ADTPQNASTG SIMGEGDVVD QDIFEVDTPS    180
SVTAGRVDAA GKAGVEQDIF EVDLSATALS SAIIGGLDMM DEDGAVQEQE SFEAVLSGNV    240
SSSPTIGEVD VVDEAGPAQD TFEVTVSGNV STSAMMGEMD AVDEAGSDHD SAETYLSGKG    300
SSSVLMMGLN AVDEVGADYD IFNIDLSGNV SRSATMGEVE AVDEAGTDHG TFGTYLSIAA    360
TGEVGVVDEA GVDRDIFETD LSGNVSRSAA TGQVNAVDEA GADQDKFKVN LSGNIAISVA    420
HEEVDVMDDA RAEGTLEMDL SGSVSGNDEE EAYEQLYPAL STIPMGGNAM DKTPVCLKPE    480
LTLVRVHEQG ESNLSVHEQE ESTVTFYEQN QLAIPFREQE LTIIAFDKQN LPTAKFPKQD    540
QSIAALSEQK KSIVASYRQD RSILDLPEQH QSIIGSHKHD KSIADASEQI HSIVGSFKQR    600
QSIVAFRKQD QAIVSVPKQK QSIVAFRKQD LSIVGLQKQN VSIIDTSGEE QTKQVAVIDR    660
HDALHMKGVE AKDEYYTYQK DGGHALHVNF DVDNLLQKHQ TERTEEAVGM TTSKKVNEEH    720
ISMTEDQIGA AKEQMIVTED GLSMNEVGTG VGDKVEHLLS EEELSQAEDE VGLIEDDGQY    780
EVDETSVSVE PDIQELPQDV VDPHELQRML QELAGKNYSM GNKLFVFPEV VKADSVIDLY    840
LNRDLTALAS EPDVVIKGAF NGWKWRLFTE RLNKSDLGGV WWSCKLYIPK EAYRLDFVFF    900
NGRSVYENNG NNDFFIEIES TMDEDIFEDF LVKEKQRELE RLAIEEAERR TQTEEQRRRK    960
EEKAADEAIW AQVKAEVETK KNKLHNMLSL ARTCVDNLWY TDTSTDTRGD TVRLYYNRNS    1020
RPLMYSTEIW MHGGYNNWTD GLSIVERLVK CNDKNGDWWH ADVILPEKAL VLDWVLADGP    1080
PGNARTYDNN GRQDFHAILP NVWTEEGYWV QEEHNIYTRL LQERREREEA IKRKTERSAK    1140
MKAEMKAKTM RRFLLSQKHI VYTEPLEICA GTTVEIIYNP SNTVLNGKPE VWFRGSFNLW    1200
MHPSGALPPQ KMVKVQDGSL LKATVSVPPD AYMLDFVFSE SEDGGIYDNR NGMDYHIPVS    1260
DSIGTEDHMH IVHIAVEMAP IAKVGGLGDV VTSLSRAVQD LGHTVEVILP KYDCLKQSSV    1320
KNLHLYTSFS WGGTEIKVWT GLVEDLLVYF LEPQNGMFEV GCVYGRNDDR RFGFFCHSAL    1380
EFLLQNGSSP HIIHCHDWSS APVAWIYKEH YAQSRLASAR VVFTIHNLEF GAQYISKAMA    1440
YCDKATTVSH TYSREVTGHG AIAPHREKFY GILNGIDQDI WDPYTDDFLP VSYTSENVVE    1500
GKSAAKRALQ QKFGLQQTDV PIVGIITRLT PQKGIHLIKH AIHRTLESNG QVVLLGSAPD    1560
PRIQGDFCRL ADSLHGVYHG RVKLALTYDE PLSRLIYAGS DFILVPSIFE PCGLTQLVAM    1620
RYGSVPIVRK TGGLYDTVFD VDNDRERARS LGLEPNGFSF NGADSNGVDY ALNRAIAAWF    1680
DARDWFHSLC KRVMEQDWSW NRPALDYIEL YHSARKF*                            1740
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR02095glgA1.0e-15312691714489+
PRK00654glgA7.0e-16112691716484+
cd03791GT1_Glycogen_synthase_DULL1_like1.0e-16712701713490+
PLN02316PLN02316071717161003+
Gene Ontology
GO TermDescription
GO:0009058biosynthetic process
GO:2001070starch binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAF87999.101171711628AF258608_1 starch synthase III [Triticum aestivum]
GenBankAAF88000.101171711611starch synthase III [Aegilops tauschii]
DDBJBAD05589.101171711790putative starch synthase DULL1 [Oryza sativa Japonica Group]
GenBankEEC83025.103171711781hypothetical protein OsI_28103 [Oryza sativa Indica Group]
GenBankEEE68179.103171711781hypothetical protein OsJ_26314 [Oryza sativa Japonica Group]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3d1j_A0126917121474A Chain A, Crystal Structure Of E.Coli Gs Mutant Dmgs(C7s;c40
PDB3guh_A0126917151477A Chain A, Crystal Structure Of E.Coli Gs Mutant Dmgs(C7s;c40
PDB2r4u_A0126917151477A Chain A, Crystal Structure Of E.Coli Gs Mutant Dmgs(C7s;c40
PDB2r4t_A0126917151477A Chain A, Crystal Structure Of E.Coli Gs Mutant Dmgs(C7s;c40
PDB2qzs_A0126917151477A Chain A, Crystal Structure Of Wild-Type E.Coli Gs In Complex With Adp And Glucose(Wtgsb)
Metabolic Pathways
Pathway NameReactionECProtein Name
starch biosynthesisGLYCOGENSYN-RXNEC-2.4.1.21starch synthase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO794758568115117170
HO77800373778215130
HO651392412130617160
GT033751341132016600
HO7947581108169187.6
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_005_00047.2.247.331Aquca_005_00047.2.247.331Aquca_005_00047.2.247.331Aquca_005_00047.1.247.331Aquca_005_00047.1.247.331
Aquca_005_00047.1.247.331Aquca_005_00047.1.423.513Aquca_005_00047.1.423.513Aquca_005_00047.1.423.513Aquca_005_00047.2.581.669
Aquca_005_00047.2.581.669Aquca_005_00047.2.581.669Aquca_005_00047.1.585.673Aquca_005_00047.1.585.673Aquca_005_00047.1.585.673
Aquca_005_00047.2.423.509Aquca_005_00047.2.423.509Aquca_005_00047.2.423.509
Arabidopsis lyrata312200.125.208312200.125.208312200.125.208312200.474.562312200.474.562
312200.474.562312200.300.401312200.300.401312200.300.401
Arabidopsis thalianaAT1G11720.2.206.289AT1G11720.2.206.289AT1G11720.2.206.289AT1G11720.1.154.237AT1G11720.1.154.237
AT1G11720.1.154.237AT1G11720.2.381.475AT1G11720.2.381.475AT1G11720.2.381.475AT1G11720.1.329.423
AT1G11720.1.329.423AT1G11720.1.329.423AT1G11720.2.548.636AT1G11720.2.548.636AT1G11720.2.548.636
AT1G11720.1.496.584AT1G11720.1.496.584AT1G11720.1.496.584
Brachypodium distachyonBradi5g22310.1.403.486Bradi5g22310.1.403.486Bradi5g22310.1.403.486Bradi3g15027.1.835.918Bradi3g15027.1.835.918
Bradi3g15027.1.835.918Bradi5g22310.1.577.667Bradi5g22310.1.577.667Bradi5g22310.1.577.667Bradi5g22310.1.739.827
Bradi5g22310.1.739.827Bradi5g22310.1.739.827
Brassica rapaBra016818.430.514Bra016818.430.514Bra016818.430.514Bra019836.120.208Bra016818.605.694
Bra016818.605.694Bra016818.605.694Bra016818.767.855Bra016818.767.855Bra016818.767.855
Carica papayaevm.model.supercontig_152.17.311.394evm.model.supercontig_152.17.311.394evm.model.supercontig_152.17.311.394evm.model.supercontig_152.17.486.575evm.model.supercontig_152.17.486.575
evm.model.supercontig_152.17.486.575evm.model.supercontig_152.17.647.735evm.model.supercontig_152.17.647.735evm.model.supercontig_152.17.647.735
Capsella rubellaCarubv10011175m.206.289Carubv10011175m.206.289Carubv10011175m.206.289Carubv10011175m.381.474Carubv10011175m.381.474
Carubv10011175m.381.474Carubv10011175m.547.635Carubv10011175m.547.635Carubv10011175m.547.635
Chlamydomonas reinhardtiiCre06.g282000.t2.1.660.749Cre06.g282000.t2.1.660.749Cre06.g282000.t1.3.696.785Cre06.g282000.t1.3.696.785Cre06.g282000.t2.1.308.399
Cre06.g282000.t2.1.308.399Cre06.g282000.t1.3.344.435Cre06.g282000.t1.3.344.435
Citrus clementinaCiclev10014319m.155.243Ciclev10014319m.155.243
Citrus sinensisorange1.1g046057m.276.359orange1.1g046057m.276.359orange1.1g046057m.276.359orange1.1g046057m.452.540orange1.1g046057m.452.540
orange1.1g046057m.452.540orange1.1g046057m.612.700orange1.1g046057m.612.700orange1.1g046057m.612.700
Cucumis sativusCucsa.085800.2.269.352Cucsa.085800.2.269.352Cucsa.085800.2.269.352Cucsa.085800.1.269.352Cucsa.085800.1.269.352
Cucsa.085800.1.269.352Cucsa.085800.2.443.534Cucsa.085800.2.443.534Cucsa.085800.2.443.534Cucsa.085800.1.443.534
Cucsa.085800.1.443.534Cucsa.085800.1.443.534Cucsa.085800.2.607.694Cucsa.085800.2.607.694Cucsa.085800.2.607.694
Cucsa.085800.1.607.694Cucsa.085800.1.607.694Cucsa.085800.1.607.694
Eucalyptus grandisEucgr.D01324.4.304.386Eucgr.D01324.4.304.386Eucgr.D01324.4.304.386Eucgr.D01324.3.304.386Eucgr.D01324.3.304.386
Eucgr.D01324.3.304.386Eucgr.D01324.2.304.386Eucgr.D01324.2.304.386Eucgr.D01324.2.304.386Eucgr.D01324.1.309.391
Eucgr.D01324.1.309.391Eucgr.D01324.1.309.391Eucgr.D01324.4.478.567Eucgr.D01324.4.478.567Eucgr.D01324.4.478.567
Eucgr.D01324.3.478.567Eucgr.D01324.3.478.567Eucgr.D01324.3.478.567Eucgr.D01324.2.478.567Eucgr.D01324.2.478.567
Eucgr.D01324.2.478.567Eucgr.D01324.1.483.572Eucgr.D01324.1.483.572Eucgr.D01324.1.483.572Eucgr.D01324.4.639.727
Eucgr.D01324.4.639.727Eucgr.D01324.4.639.727Eucgr.D01324.3.639.727Eucgr.D01324.3.639.727Eucgr.D01324.3.639.727
Eucgr.D01324.2.639.727Eucgr.D01324.2.639.727Eucgr.D01324.2.639.727Eucgr.D01324.1.644.732Eucgr.D01324.1.644.732
Eucgr.D01324.1.644.732
Fragaria vescamrna19625.1-v1.0-hybrid.209.292mrna19625.1-v1.0-hybrid.209.292mrna19625.1-v1.0-hybrid.209.292mrna19625.1-v1.0-hybrid.384.473mrna19625.1-v1.0-hybrid.384.473
mrna19625.1-v1.0-hybrid.384.473mrna19625.1-v1.0-hybrid.546.633mrna19625.1-v1.0-hybrid.546.633mrna19625.1-v1.0-hybrid.546.633
Glycine maxGlyma13g27480.1.265.348Glyma13g27480.1.265.348Glyma13g27480.1.265.348Glyma15g11500.1.282.365Glyma15g11500.1.282.365
Glyma15g11500.1.282.365Glyma07g39040.2.196.281Glyma07g39040.2.196.281Glyma07g39040.2.196.281Glyma15g11500.1.459.546
Glyma15g11500.1.459.546Glyma15g11500.1.459.546Glyma13g27480.1.442.529Glyma13g27480.1.442.529Glyma13g27480.1.442.529
Glyma07g39040.2.374.462Glyma07g39040.2.374.462Glyma07g39040.2.374.462Glyma15g11500.1.618.706Glyma15g11500.1.618.706
Glyma15g11500.1.618.706Glyma07g39040.2.534.622Glyma07g39040.2.534.622Glyma07g39040.2.534.622Glyma13g27480.1.601.689
Glyma13g27480.1.601.689Glyma13g27480.1.601.689
Gossypium raimondiiGorai.011G013800.6.270.352Gorai.011G013800.6.270.352Gorai.011G013800.6.270.352Gorai.011G013800.5.192.274Gorai.011G013800.5.192.274
Gorai.011G013800.5.192.274Gorai.011G013800.4.192.274Gorai.011G013800.4.192.274Gorai.011G013800.4.192.274Gorai.011G013800.3.192.274
Gorai.011G013800.3.192.274Gorai.011G013800.3.192.274Gorai.011G013800.2.270.352Gorai.011G013800.2.270.352Gorai.011G013800.2.270.352
Gorai.011G013800.1.270.352Gorai.011G013800.1.270.352Gorai.011G013800.1.270.352Gorai.009G178700.6.279.362Gorai.009G178700.6.279.362
Gorai.009G178700.6.279.362Gorai.009G178700.5.279.362Gorai.009G178700.5.279.362Gorai.009G178700.5.279.362Gorai.009G178700.4.157.240
Gorai.009G178700.4.157.240Gorai.009G178700.4.157.240Gorai.009G178700.3.279.362Gorai.009G178700.3.279.362Gorai.009G178700.3.279.362
Gorai.009G178700.2.279.362Gorai.009G178700.2.279.362Gorai.009G178700.2.279.362Gorai.009G178700.1.279.362Gorai.009G178700.1.279.362
Gorai.009G178700.1.279.362Gorai.011G013800.6.444.533Gorai.011G013800.6.444.533Gorai.011G013800.6.444.533Gorai.011G013800.5.366.455
Gorai.011G013800.5.366.455Gorai.011G013800.5.366.455Gorai.011G013800.4.366.455Gorai.011G013800.4.366.455Gorai.011G013800.4.366.455
Gorai.011G013800.3.366.455Gorai.011G013800.3.366.455Gorai.011G013800.3.366.455Gorai.011G013800.2.444.533Gorai.011G013800.2.444.533
Gorai.011G013800.2.444.533Gorai.011G013800.1.444.533Gorai.011G013800.1.444.533Gorai.011G013800.1.444.533Gorai.009G178700.6.454.543
Gorai.009G178700.6.454.543Gorai.009G178700.6.454.543Gorai.009G178700.5.454.543Gorai.009G178700.5.454.543Gorai.009G178700.5.454.543
Gorai.009G178700.4.332.421Gorai.009G178700.4.332.421Gorai.009G178700.4.332.421Gorai.009G178700.3.454.543Gorai.009G178700.3.454.543
Gorai.009G178700.3.454.543Gorai.009G178700.2.454.543Gorai.009G178700.2.454.543Gorai.009G178700.2.454.543Gorai.009G178700.1.454.543
Gorai.009G178700.1.454.543Gorai.009G178700.1.454.543Gorai.009G178700.6.615.703Gorai.009G178700.6.615.703Gorai.009G178700.6.615.703
Gorai.009G178700.5.615.703Gorai.009G178700.5.615.703Gorai.009G178700.5.615.703Gorai.009G178700.4.493.581Gorai.009G178700.4.493.581
Gorai.009G178700.4.493.581Gorai.009G178700.3.615.703Gorai.009G178700.3.615.703Gorai.009G178700.3.615.703Gorai.009G178700.2.615.703
Gorai.009G178700.2.615.703Gorai.009G178700.2.615.703Gorai.009G178700.1.615.703Gorai.009G178700.1.615.703Gorai.009G178700.1.615.703
Gorai.011G013800.6.606.693Gorai.011G013800.6.606.693Gorai.011G013800.6.606.693Gorai.011G013800.5.528.615Gorai.011G013800.5.528.615
Gorai.011G013800.5.528.615Gorai.011G013800.4.528.615Gorai.011G013800.4.528.615Gorai.011G013800.4.528.615Gorai.011G013800.3.528.615
Gorai.011G013800.3.528.615Gorai.011G013800.3.528.615Gorai.011G013800.2.606.693Gorai.011G013800.2.606.693Gorai.011G013800.2.606.693
Gorai.011G013800.1.606.693Gorai.011G013800.1.606.693Gorai.011G013800.1.606.693
Linum usitatissimumLus10020044.225.308Lus10020044.225.308Lus10020044.225.308Lus10006780.228.311Lus10006780.228.311
Lus10006780.228.311Lus10006780.565.653Lus10006780.565.653Lus10006780.565.653Lus10020044.562.650
Lus10020044.562.650Lus10020044.562.650Lus10006780.404.493Lus10006780.404.493Lus10006780.404.493
Lus10020044.401.490Lus10020044.401.490Lus10020044.401.490
Malus domesticaMDP0000191201.257.340MDP0000191201.257.340MDP0000191201.257.340MDP0000151462.257.340MDP0000151462.257.340
MDP0000151462.257.340MDP0000252413.204.287MDP0000252413.204.287MDP0000191201.433.521MDP0000191201.433.521
MDP0000191201.433.521MDP0000151462.433.521MDP0000151462.433.521MDP0000151462.433.521MDP0000585054.156.244
MDP0000585054.156.244MDP0000252413.380.468MDP0000252413.380.468MDP0000191201.594.681MDP0000191201.594.681
MDP0000191201.594.681MDP0000151462.594.681MDP0000151462.594.681MDP0000151462.594.681
Manihot esculentacassava4.1_000528m.264.347cassava4.1_000528m.264.347cassava4.1_000528m.264.347cassava4.1_001042m.91.174cassava4.1_001042m.91.174
cassava4.1_001042m.91.174cassava4.1_000528m.440.528cassava4.1_000528m.440.528cassava4.1_000528m.440.528cassava4.1_001042m.261.348
cassava4.1_001042m.261.348cassava4.1_001042m.261.348cassava4.1_001042m.421.508cassava4.1_001042m.421.508cassava4.1_001042m.421.508
cassava4.1_000528m.601.688cassava4.1_000528m.601.688cassava4.1_000528m.601.688
Mimulus guttatusmgv1a000364m.363.446mgv1a000364m.363.446mgv1a000364m.670.758mgv1a000364m.670.758
Oryza sativaLOC_Os08g09230.2.906.989LOC_Os08g09230.2.906.989LOC_Os08g09230.2.906.989LOC_Os08g09230.1.906.989LOC_Os08g09230.1.906.989
LOC_Os08g09230.1.906.989LOC_Os04g53310.1.334.417LOC_Os04g53310.1.334.417LOC_Os04g53310.1.334.417LOC_Os04g53310.1.508.598
LOC_Os04g53310.1.508.598LOC_Os04g53310.1.508.598LOC_Os04g53310.1.670.758LOC_Os04g53310.1.670.758LOC_Os04g53310.1.670.758
Panicum virgatumPavirv00054440m.151.234Pavirv00054440m.151.234Pavirv00054440m.151.234Pavirv00009477m.238.321Pavirv00009477m.238.321
Pavirv00009477m.238.321Pavirv00019877m.488.571Pavirv00019877m.488.571Pavirv00019877m.488.571Pavirv00009007m.640.723
Pavirv00009007m.640.723Pavirv00009007m.640.723Pavirv00069992m.620.703Pavirv00069992m.620.703Pavirv00069992m.620.703
Pavirv00054440m.325.415Pavirv00054440m.325.415Pavirv00054440m.325.415Pavirv00054440m.487.575Pavirv00054440m.487.575
Pavirv00054440m.487.575Pavirv00069992m.795.882Pavirv00069992m.795.882Pavirv00069992m.795.882Pavirv00009477m.412.502
Pavirv00009477m.412.502Pavirv00009477m.412.502Pavirv00009477m.574.662Pavirv00009477m.574.662Pavirv00009477m.574.662
Pavirv00019877m.663.750Pavirv00019877m.663.750Pavirv00019877m.663.750Pavirv00019877m.824.912Pavirv00019877m.824.912
Pavirv00019877m.824.912Pavirv00009007m.815.902Pavirv00009007m.815.902Pavirv00009007m.815.902
Phaseolus vulgarisPhvul.011G151400.1.281.364Phvul.011G151400.1.281.364Phvul.011G151400.1.281.364Phvul.003G078800.1.198.283Phvul.003G078800.1.198.283
Phvul.003G078800.1.198.283Phvul.011G151400.1.458.545Phvul.011G151400.1.458.545Phvul.011G151400.1.458.545Phvul.003G078800.1.377.463
Phvul.003G078800.1.377.463Phvul.003G078800.1.377.463Phvul.011G151400.1.617.705Phvul.011G151400.1.617.705Phvul.011G151400.1.617.705
Phvul.003G078800.1.536.624Phvul.003G078800.1.536.624Phvul.003G078800.1.536.624
Picea abiesMA_10437241g0010.202.286MA_10437241g0010.202.286MA_10437241g0010.202.286MA_10437241g0010.377.467MA_10437241g0010.377.467
MA_10437241g0010.377.467MA_10437241g0010.540.629MA_10437241g0010.540.629MA_10437241g0010.540.629
Populus trichocarpaPotri.004G014100.2.162.245Potri.004G014100.2.162.245Potri.004G014100.2.162.245Potri.004G014100.1.281.364Potri.004G014100.1.281.364
Potri.004G014100.1.281.364Potri.004G014100.2.337.426Potri.004G014100.2.337.426Potri.004G014100.2.337.426Potri.004G014100.1.456.545
Potri.004G014100.1.456.545Potri.004G014100.1.456.545Potri.004G014100.2.498.586Potri.004G014100.2.498.586Potri.004G014100.2.498.586
Potri.004G014100.1.617.705Potri.004G014100.1.617.705Potri.004G014100.1.617.705
Prunus persicappa001074m.35.118ppa001074m.35.118ppa001074m.35.118ppa001074m.211.299ppa001074m.211.299
ppa001074m.211.299ppa001074m.372.460ppa001074m.372.460ppa001074m.372.460
Ricinus communis29842.m003588.184.26729842.m003588.184.26729842.m003588.184.26729842.m003588.389.47729842.m003588.389.477
29842.m003588.389.47729842.m003588.550.63729842.m003588.550.63729842.m003588.550.637
Setaria italicaSi013121m.535.618Si013121m.535.618Si013121m.535.618Si009214m.272.354Si009214m.272.354
Si009214m.272.354Si015393m.625.708Si015393m.625.708Si015393m.625.708Si009214m.445.535
Si009214m.445.535Si009214m.445.535Si009214m.607.695Si009214m.607.695Si009214m.607.695
Si013121m.706.793Si013121m.706.793Si013121m.706.793Si013121m.868.956Si013121m.868.956
Si013121m.868.956Si015393m.801.887Si015393m.801.887Si015393m.801.887
Selaginella moellendorffii154776.15.97154776.15.97154776.15.97154776.189.279154776.189.279
154776.189.279154776.351.441154776.351.441154776.351.441
Sorghum bicolorSb06g029050.1.309.392Sb06g029050.1.309.392Sb06g029050.1.309.392Sb07g005400.1.782.865Sb07g005400.1.782.865
Sb07g005400.1.782.865Sb06g029050.1.483.573Sb06g029050.1.483.573Sb06g029050.1.483.573Sb06g029050.1.645.733
Sb06g029050.1.645.733Sb06g029050.1.645.733
Thellungiella halophilaThhalv10006781m.209.292Thhalv10006781m.209.292Thhalv10006781m.209.292Thhalv10006631m.209.292Thhalv10006631m.209.292
Thhalv10006631m.209.292Thhalv10006781m.384.477Thhalv10006781m.384.477Thhalv10006781m.384.477Thhalv10006631m.384.477
Thhalv10006631m.384.477Thhalv10006631m.384.477Thhalv10006781m.549.638Thhalv10006781m.549.638Thhalv10006781m.549.638
Thhalv10006631m.549.638Thhalv10006631m.549.638Thhalv10006631m.549.638
Vitis viniferaGSVIVT01012723001.340.428GSVIVT01012723001.340.428GSVIVT01012723001.500.588GSVIVT01012723001.500.588
Volvox carteriVocar20002632m.688.777Vocar20002632m.688.777Vocar20002632m.313.404Vocar20002632m.313.404
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)