y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi3g15530.1
FamilyGT1
Protein PropertiesLength: 520 Molecular Weight: 56510.3 Isoelectric Point: 5.7002
ChromosomeChromosome/Scaffold: 3 Start: 13809484 End: 13816827
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT11194995.1e-28
  CHHWLPPIAHHHNVPCAVFWIVRVNTTGEHPPRTAPEDFTVPPSWMTPASSSAAAYHRHEAWWIVGTLSEDASGVSDMERTWRVLDACHLTIYRSSEEVE
  PRMFDLLTHLLKKPAVPAGILLPSSNIDNNDGSNSEGVLRWDPSVRFLLFSREELERLTRGDTLTVGSTSQSSAPVASGNCLAGTSPELRCSAARARASS
  KALSGVARSVIYVALGSEAPLTGKDIHELALGLELAGVRFLWALRKPSGMFSSTDEQLLPTGFEERTRSQGLVCTGWVPQVRALAHDATGAFLTHCGWGS
  TAESLAFGHPLVMLPFVVDQPLIGRMMAAKGIGVEVARDGDNGGSFDRDGVAVAVRRVMVEDEGKVFASNAKLQELLTDQG
Full Sequence
Protein Sequence     Length: 520     Download
MAEMEAVLEV VVFPWLAVGH MIPFLELAER LAARGHAVSF VSTPGNLARL PPSPRLRFVP    60
LPLPRVEVLP EGAESTADVV PGNGDDGLLK KAFDGLAAPF AAFLAGCERK PDWVINDFCH    120
HWLPPIAHHH NVPCAVFWIV RVNTTGEHPP RTAPEDFTVP PSWMTPASSS AAAYHRHEAW    180
WIVGTLSEDA SGVSDMERTW RVLDACHLTI YRSSEEVEPR MFDLLTHLLK KPAVPAGILL    240
PSSNIDNNDG SNSEGVLRWD PSVRFLLFSR EELERLTRGD TLTVGSTSQS SAPVASGNCL    300
AGTSPELRCS AARARASSKA LSGVARSVIY VALGSEAPLT GKDIHELALG LELAGVRFLW    360
ALRKPSGMFS STDEQLLPTG FEERTRSQGL VCTGWVPQVR ALAHDATGAF LTHCGWGSTA    420
ESLAFGHPLV MLPFVVDQPL IGRMMAAKGI GVEVARDGDN GGSFDRDGVA VAVRRVMVED    480
EGKVFASNAK LQELLTDQGR QERYMDELVE HLRRYKDDD*                          540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02208PLN022087.0e-1013241235+
PLN03015PLN030152.0e-30326454135+
PLN02208PLN022082.0e-31321515200+
PLN02670PLN026705.0e-3413241246+
PLN02670PLN026709.0e-46325513190+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEAZ03128.10851623507hypothetical protein OsI_25274 [Oryza sativa Indica Group]
GenBankEEC81695.1010516221698hypothetical protein OsI_25291 [Oryza sativa Indica Group]
GenBankEEE66752.104351670516hypothetical protein OsJ_23460 [Oryza sativa Japonica Group]
RefSeqNP_001059134.10851029490Os07g0202000 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002463702.10851811484hypothetical protein SORBIDRAFT_01g004560 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vg8_A1e-28327494269442B Chain B, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector
PDB2vch_A1e-28327494269442B Chain B, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector
PDB2vce_A1e-28327494269442A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2c9z_A7e-23327517272455A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2c1z_A7e-23327517272455A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
Metabolic Pathways
Pathway NameReactionECProtein Name
curcumin glucoside biosynthesisRXN-7062EC-2.4.1UDP-glucose:curcumin glucosyltransferase
curcumin glucoside biosynthesisRXN-7063EC-2.4.1UDP-glucose:curcumin monoglucoside glucosyltransferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HX1944371983265180
HX1459921973265170
CX6163121893355180
FE6449591863375190
HX145992482122590.01
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_007_00750.1Aquca_007_00751.1Aquca_010_00258.1Aquca_010_00256.1Aquca_010_00261.1
Aquca_010_00260.1Aquca_010_00255.1Aquca_010_00259.1Aquca_010_00262.1Aquca_010_00263.1
Aquca_027_00408.1Aquca_012_00004.1Aquca_006_00056.1Aquca_031_00090.1
Arabidopsis lyrata481118357219
Arabidopsis thalianaAT2G22590.1AT5G49690.1AT5G65550.1
Brachypodium distachyonBradi1g10820.1Bradi1g10840.1Bradi5g21180.1Bradi5g21170.1Bradi5g21190.1
Bradi1g10860.1Bradi1g10850.1Bradi2g55960.1Bradi3g01880.1Bradi1g04890.1
Bradi1g04880.1Bradi2g34500.1Bradi1g28180.1Bradi1g18140.1
Brassica rapaBra035271Bra037821Bra010190
Carica papayaevm.model.supercontig_42.123evm.model.supercontig_55.12evm.model.supercontig_42.124evm.model.supercontig_19.19
Capsella rubellaCarubv10023135mCarubv10018560mCarubv10019108mCarubv10028581m
Citrus clementinaCiclev10025508mCiclev10010307mCiclev10019998mCiclev10033373mCiclev10030045m
Ciclev10030271mCiclev10033610m
Citrus sinensisorange1.1g011765morange1.1g036520morange1.1g042362morange1.1g046033morange1.1g044441m
orange1.1g038300m
Cucumis sativusCucsa.103930.1Cucsa.103920.1Cucsa.103910.1Cucsa.103890.1Cucsa.312060.1
Cucsa.364760.1Cucsa.153020.1Cucsa.153030.1Cucsa.153040.1
Eucalyptus grandisEucgr.H02446.1Eucgr.H02441.1Eucgr.H02445.1Eucgr.H02443.1Eucgr.F00432.1
Eucgr.I02617.1Eucgr.C00857.1Eucgr.C00861.1Eucgr.C03413.1Eucgr.C00864.1
Eucgr.C03414.1Eucgr.C03411.1Eucgr.C00863.1Eucgr.C00854.1Eucgr.C00858.1
Eucgr.J01013.1Eucgr.J00447.1Eucgr.J01007.1Eucgr.J01015.1Eucgr.J01009.1
Eucgr.J01005.1Eucgr.J02585.1Eucgr.J01008.1Eucgr.B03886.1Eucgr.J01006.1
Fragaria vescamrna12684.1-v1.0-hybridmrna34393.1-v1.0-hybridmrna35023.1-v1.0-hybridmrna35022.1-v1.0-hybridmrna35024.1-v1.0-hybrid
mrna35028.1-v1.0-hybridmrna35021.1-v1.0-hybrid
Glycine maxGlyma18g29100.1Glyma18g29380.1Glyma15g05710.2Glyma15g05710.1Glyma08g19290.1
Glyma10g16790.1Glyma07g07340.2Glyma07g07340.1Glyma07g07320.1Glyma16g03715.1
Glyma07g07330.1Glyma16g03700.2
Gossypium raimondiiGorai.010G033600.1Gorai.008G120300.1Gorai.013G021000.1Gorai.013G021100.2Gorai.013G021100.1
Gorai.009G033400.1Gorai.009G033100.1Gorai.002G145800.1
Linum usitatissimumLus10012726Lus10025711Lus10035951Lus10027850Lus10042242
Lus10043445Lus10008955Lus10028865Lus10028863Lus10006280
Lus10028864Lus10008956
Malus domesticaMDP0000752882MDP0000463584MDP0000314729.279.471MDP0000314729.279.471MDP0000314729.624.988
MDP0000314729.624.988MDP0000156075MDP0000200513MDP0000552242MDP0000548004
MDP0000435644MDP0000548003MDP0000167917MDP0000723497MDP0000580411
MDP0000617184MDP0000208069MDP0000288554MDP0000137451MDP0000561022
MDP0000440622MDP0000172933MDP0000196404MDP0000200971MDP0000299015
MDP0000174666MDP0000391619
Manihot esculentacassava4.1_025011mcassava4.1_020934mcassava4.1_011289mcassava4.1_023926mcassava4.1_033369m
cassava4.1_007146mcassava4.1_026868mcassava4.1_024465mcassava4.1_031328mcassava4.1_030489m
Medicago truncatulaMedtr2g008226.1Medtr6g042310.1Medtr4g078060.1Medtr4g077960.1Medtr2g008225.1
Medtr2g008220.1Medtr6g036650.1Medtr7g067330.1Medtr5g066410.1
Mimulus guttatusmgv1a005472mmgv1a018729mmgv1a014831mmgv1a026446mmgv1a019146m
mgv1a006194mmgv1a026213mmgv1a006481mmgv1a006511mmgv1a021717m
mgv1a019912mmgv1a021692mmgv1a019121mmgv1a022198mmgv1a020989m
mgv1a020418mmgv1a007199m
Oryza sativaLOC_Os03g49524.1LOC_Os10g03320.1LOC_Os03g49550.1LOC_Os07g10230.1LOC_Os03g59030.1
LOC_Os01g64540.1LOC_Os07g10190.1LOC_Os02g37690.1LOC_Os02g56010.1LOC_Os06g11270.1
LOC_Os12g37510.1LOC_Os07g10240.1LOC_Os07g10160.1LOC_Os07g47550.1
Panicum virgatumPavirv00011720mPavirv00050442mPavirv00030013mPavirv00002233mPavirv00046126m
Pavirv00067656mPavirv00023654mPavirv00010237mPavirv00018444mPavirv00010014m
Pavirv00051008mPavirv00017197mPavirv00011180mPavirv00011096mPavirv00046125m
Pavirv00055895mPavirv00062224mPavirv00018700mPavirv00024351mPavirv00070116m
Pavirv00061292mPavirv00038203mPavirv00066605mPavirv00057124mPavirv00046064m
Pavirv00064272mPavirv00008442mPavirv00062222m
Physcomitrella patensPp1s317_44V6.1
Phaseolus vulgarisPhvul.003G288100.1Phvul.003G288200.1Phvul.006G208400.1Phvul.010G036800.1Phvul.006G208300.1
Phvul.010G036900.1Phvul.010G037000.1Phvul.006G208500.1Phvul.010G037600.1
Picea abiesMA_8177242g0010MA_10435428g0020MA_107397g0010MA_9720131g0020MA_477384g0010
MA_30352g0010MA_7873828g0010MA_7757922g0010MA_36867g0010MA_940843g0010
MA_10436388g0010MA_358441g0010MA_10433345g0020MA_10430052g0020MA_55163g0010
MA_13237g0010
Populus trichocarpaPotri.018G140400.1Potri.012G034100.2Potri.012G034100.1Potri.001G030600.1Potri.010G182600.1
Potri.003G184400.1Potri.002G162300.1Potri.014G088400.1Potri.017G042800.1Potri.008G024800.1
Prunus persicappa023071mppa005394mppa025411mppa005106mppa025376m
ppa005180mppa018245mppa005830mppa005532mppa016015m
ppa005471mppa014698mppa005520mppa005526m
Ricinus communis27482.m00014529235.m00024329235.m00024027482.m00014629596.m000721
29235.m00024230174.m00864529939.m000531
Setaria italicaSi027901mSi026288mSi026285mSi035671mSi001332m
Si001301mSi035772mSi006373mSi035396mSi038868m
Si026297mSi040087mSi029576mSi029678mSi040021m
Si029633mSi029677mSi038926mSi029638mSi033256m
Si032166m
Selaginella moellendorffii157053
Sorghum bicolorSb01g010900.1Sb03g040840.1Sb03g040830.1Sb01g004570.1Sb01g004560.1
Sb02g026040.1Sb02g005940.1Sb02g005913.1Sb02g042580.1Sb01g004580.1
Thellungiella halophilaThhalv10000154mThhalv10028640mThhalv10007607m
Vitis viniferaGSVIVT01026987001GSVIVT01003960001.249.435GSVIVT01003960001.249.435GSVIVT01003960001.249.435GSVIVT01026986001.206.376
GSVIVT01026986001.206.376GSVIVT01026986001.540.740GSVIVT01026986001.540.740GSVIVT01026464001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)