y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi3g19840.1
FamilyPL1
Protein PropertiesLength: 139 Molecular Weight: 15503.5 Isoelectric Point: 10.7288
ChromosomeChromosome/Scaffold: 3 Start: 18809562 End: 18810242
DescriptionPectin lyase-like superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
PL11581.6e-22
  MRVTVAFNRFGPNVNQRMPRIRHGYAHVVNNLYDGWRDYAIGGSMGPSVKSQGNLFIA
Full Sequence
Protein Sequence     Length: 139     Download
MRVTVAFNRF GPNVNQRMPR IRHGYAHVVN NLYDGWRDYA IGGSMGPSVK SQGNLFIASP    60
GNAKVTRRMP PVEHAREKEW HWHSVGDHFE NGASFNQMGS RVRPNYNKYQ AFHAANASEV    120
RSLTKDAGAL RCFAKAAC*                                                 180
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3866PelB2.0e-102129141+
pfam00544Pec_lyase_C9.0e-2015656+
smart00656Amb_all1.0e-2416060+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAD01325.101138240384putative Cup s 1 pollen allergen [Oryza sativa Japonica Group]
GenBankEAZ06386.101138240384hypothetical protein OsI_28615 [Oryza sativa Indica Group]
RefSeqXP_002299118.19.80909e-451138214354predicted protein [Populus trichocarpa]
RefSeqXP_002304865.11.4013e-451138214352predicted protein [Populus trichocarpa]
RefSeqXP_002458626.101138237373hypothetical protein SORBIDRAFT_03g036930 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1pxz_B3e-281130213345A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB1pxz_A3e-281130213345A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB3zsc_A0.00001273183270A Chain A, Catalytic Function And Substrate Recognition Of The Pectate Lyase From Thermotoga Maritima
PDB3krg_A0.005135264297A Chain A, Structural Insights Into Substrate Specificity And The Anti Beta-Elimination Mechanism Of Pectate Lyase
PDB1vbl_A0.008152270322A Chain A, Structure Of The Thermostable Pectate Lyase Pl 47
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DR90686214111390
FM18409514111390
EB66438714011390
FM18460314111390
DW531037130121390