y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi3g25226.1
FamilyGH95
Protein PropertiesLength: 825 Molecular Weight: 90779.5 Isoelectric Point: 5.2977
ChromosomeChromosome/Scaffold: 3 Start: 24896676 End: 24916806
Description1,2-alpha-L-fucosidases
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH95378100
  ESRPLKVVFASPAKYFTDAAPIGNGRLGAMVWGGVASERLQLNHDTLWTGGPGNYTNPNAPTVLSKVRSLVGKGLYAEATAVAYDLSGDQTQIYQPLGDI
  DLAFGQHIKYTNYKRYLDLESATVNVTYTVGEVVYSREHFSSNPHQVIATKVSANKPGAVSFTVSLATPLDHRIHVTDTNEIIMEGCCAGERPVGDDSAS
  DDPTGIKFCAILYLQISGANGTLQVLNDNMLKLDGADSAVLLLAAATSFEGPFVKPSESTLNPKTSAFTTLNMARTMSYSQLKAYHMDDYQSLFQRVSLQ
  LSRGSDNVLRGNSLPNSPENSCQDIAVSHCVEQISDRSWLKELNNSDKPTVDRIISFVDDEDPSLVELLFQFGRYLLISCSRPGTQISNLQGIWSNDTRP
  PWDAAPHPNINLQMNYWPALPCNLSECQEPLFDFIESLSINGAKTAKVNYEASGWVSHQVTDLWAKTSPDAGDPMWALWPMGGSWLATHLWEHYSFTLDT
  QFLEKTAYPLLEGSASFLLSWLIEGQGGQLETNPSTSPEHYFIAPDGKKACVSYSTTMDMSVIREVFSAVLLSADILGKSGTDVVQRIKKALPRLPPIKI
  ARDITIMEWARDFQDPEVHHRHVSHLFGLYPGHTMTLEQTPDLCKAVGNSLYKRGDEGPGWSTAWKMALWAHLHNSEHAYKMILQLISLIDPKHEVEKEG
  GLYSNLFAAHPPFQIDANFGFPAALSEMLVQSTGSDLYLLPALPRDKWPHGCVKGLKARGGVTVNICWKEGQVY
Full Sequence
Protein Sequence     Length: 825     Download
MDGDGGSDCD TGGEWIWVRR LQEAEAAAVA AGWQAEESRP LKVVFASPAK YFTDAAPIGN    60
GRLGAMVWGG VASERLQLNH DTLWTGGPGN YTNPNAPTVL SKVRSLVGKG LYAEATAVAY    120
DLSGDQTQIY QPLGDIDLAF GQHIKYTNYK RYLDLESATV NVTYTVGEVV YSREHFSSNP    180
HQVIATKVSA NKPGAVSFTV SLATPLDHRI HVTDTNEIIM EGCCAGERPV GDDSASDDPT    240
GIKFCAILYL QISGANGTLQ VLNDNMLKLD GADSAVLLLA AATSFEGPFV KPSESTLNPK    300
TSAFTTLNMA RTMSYSQLKA YHMDDYQSLF QRVSLQLSRG SDNVLRGNSL PNSPENSCQD    360
IAVSHCVEQI SDRSWLKELN NSDKPTVDRI ISFVDDEDPS LVELLFQFGR YLLISCSRPG    420
TQISNLQGIW SNDTRPPWDA APHPNINLQM NYWPALPCNL SECQEPLFDF IESLSINGAK    480
TAKVNYEASG WVSHQVTDLW AKTSPDAGDP MWALWPMGGS WLATHLWEHY SFTLDTQFLE    540
KTAYPLLEGS ASFLLSWLIE GQGGQLETNP STSPEHYFIA PDGKKACVSY STTMDMSVIR    600
EVFSAVLLSA DILGKSGTDV VQRIKKALPR LPPIKIARDI TIMEWARDFQ DPEVHHRHVS    660
HLFGLYPGHT MTLEQTPDLC KAVGNSLYKR GDEGPGWSTA WKMALWAHLH NSEHAYKMIL    720
QLISLIDPKH EVEKEGGLYS NLFAAHPPFQ IDANFGFPAA LSEMLVQSTG SDLYLLPALP    780
RDKWPHGCVK GLKARGGVTV NICWKEGQVY SFSSDLKCLK TWLL*                    840
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAK98716.1018241872AC090483_6 Hypothetical protein [Oryza sativa Japonica Group]
DDBJBAF85832.10138108808alpha-1,2-fucosidase [Lilium longiflorum]
GenBankEEC66760.1018241851hypothetical protein OsI_33136 [Oryza sativa Indica Group]
RefSeqNP_001064381.1018241851Os10g0339600 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002298754.10358206798predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2rdy_B0418093737A Chain A, Crystal Structure Of A Putative Glycoside Hydrolase Family Protein From Bacillus Halodurans
PDB2rdy_A0418093737A Chain A, Crystal Structure Of A Putative Glycoside Hydrolase Family Protein From Bacillus Halodurans
PDB2eac_B048098834A Chain A, Crystal Structure Of A Putative Glycoside Hydrolase Family Protein From Bacillus Halodurans
PDB2eac_A048098834A Chain A, Crystal Structure Of A Putative Glycoside Hydrolase Family Protein From Bacillus Halodurans
PDB2eab_B048098834A Chain A, Crystal Structure Of 1,2-A-L-Fucosidase From Bifidobacterium Bifidum (Apo Form)
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO8766212955168100
GT8559772515327820
CB6197022664076720
CB6636422644567190
CJ6824662734777490
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_083_00007.1Aquca_083_00007.2Aquca_083_00007.3Aquca_083_00007.4Aquca_083_00007.5
Aquca_083_00007.6
Arabidopsis lyrata912968
Arabidopsis thalianaAT4G34260.1
Brachypodium distachyonBradi1g28366.1Bradi3g25226.2
Brassica rapaBra011514
Carica papayaevm.model.supercontig_106.113
Capsella rubellaCarubv10004274m
Citrus clementinaCiclev10027816mCiclev10027838mCiclev10027896mCiclev10027914m
Citrus sinensisorange1.1g003571morange1.1g003209morange1.1g004833morange1.1g004823morange1.1g007147m
orange1.1g007141morange1.1g007204morange1.1g010926morange1.1g012384m
Cucumis sativusCucsa.108860.1
Eucalyptus grandisEucgr.I01092.1Eucgr.I01093.1Eucgr.I01092.2Eucgr.I01091.1Eucgr.I01092.3
Fragaria vescamrna22851.1-v1.0-hybrid.28.414mrna22851.1-v1.0-hybrid.28.414mrna22843.1-v1.0-hybrid.28.420mrna22843.1-v1.0-hybrid.28.420mrna22843.1-v1.0-hybrid.490.804
mrna22843.1-v1.0-hybrid.490.804mrna22851.1-v1.0-hybrid.412.731mrna22851.1-v1.0-hybrid.412.731
Glycine maxGlyma20g26646.1Glyma10g40690.1Glyma20g26653.1Glyma01g45470.1Glyma10g40690.2
Glyma10g40690.3Glyma10g40690.4Glyma01g45470.2
Gossypium raimondiiGorai.008G022000.1Gorai.008G022200.1Gorai.008G022200.3Gorai.008G022200.2Gorai.008G022000.2
Gorai.008G022000.3
Linum usitatissimumLus10020979Lus10026594Lus10029689Lus10013884Lus10026595.318.693
Lus10026595.318.693Lus10026595.49.314Lus10026595.49.314
Malus domesticaMDP0000212784MDP0000623980MDP0000623979
Manihot esculentacassava4.1_001723mcassava4.1_005093mcassava4.1_008652mcassava4.1_021629m
Medicago truncatulaMedtr4g127370.1
Mimulus guttatusmgv1a001249m
Oryza sativaLOC_Os10g19334.1LOC_Os10g19880.1LOC_Os10g19334.2
Panicum virgatumPavirv00068345mPavirv00058326mPavirv00053527mPavirv00056040mPavirv00052622m
Pavirv00070327mPavirv00065921m
Physcomitrella patensPp1s174_46V6.2.375.814Pp1s174_46V6.2.375.814Pp1s174_46V6.1.375.814Pp1s174_46V6.1.375.814Pp1s11165_1V6.1
Phaseolus vulgarisPhvul.007G041400.1Phvul.002G053000.1
Picea abiesMA_6830674g0010MA_10427365g0010
Populus trichocarpaPotri.009G093900.1Potri.001G299000.6Potri.001G299000.1Potri.009G093500.1Potri.001G298900.1
Potri.001G299000.4Potri.009G093500.3Potri.001G298900.2Potri.001G299000.9Potri.001G299000.7
Potri.009G093500.2Potri.001G299000.5Potri.001G299000.2Potri.001G299000.3Potri.001G299000.11
Potri.009G093500.4Potri.001G299000.10Potri.001G299000.8Potri.001G299000.12
Prunus persicappa001398m
Ricinus communis28152.m00088228152.m000881
Setaria italicaSi040042mSi035391mSi040167mSi037248mSi037505m
Selaginella moellendorffii171005
Sorghum bicolorSb02g007180.1
Thellungiella halophilaThhalv10024398m
Vitis viniferaGSVIVT01037900001.265.748GSVIVT01037900001.265.748GSVIVT01037900001.32.242GSVIVT01037900001.32.242
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)