y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi3g26780.4
FamilyCE10
Protein PropertiesLength: 776 Molecular Weight: 84895.9 Isoelectric Point: 5.4494
ChromosomeChromosome/Scaffold: 3 Start: 27537258 End: 27545486
Descriptionacylaminoacyl-peptidase-related
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE105347555.1e-31
  CKDSTSSPTVVVLHGGPHSVYPSSYSKSLAFLYAQGYNLLVVNYRGSLGFGEEALQSLPGNIGSQDVNDVLTALDFVTKRGLIDASRVAVVGGSHGGFLT
  THLIGQAPETFVAAAARNPVCNLSLMVGTTDIPEWCFLEMYGKEGKNCFTESPSAETLAQFYEKSPISHISKVKTPTLFLLGAKDLRVPVSNGLQYARTM
  KERGLETKIIVFPEDNHGLDKP
Full Sequence
Protein Sequence     Length: 776     Download
MDDAHACEAA TDKGLPSGID ASMVDEYASQ SKLLQEFVKI PNIGKAWIFS SKNENTSRAM    60
VSIGQSDLLA NKKRNFLLNS HISKSAAKSV NFQWSPFPIE MSGVSAIVPS PSGEKLLLVR    120
NAEDDSPTKL EIWGPCQLEN EIHIPKYVHG SLYADAWFEG ISWNQEETFI AYVAEEPPQP    180
KPEFNDSGYK KECSSQKDCK SWKGQGDWED NWGETYSKKR IPALFVANIS SGEVRTVKGI    240
SRSLSVGQVV WSPSSSYSLV FVAWSDDNGF QETPRKLGIV YCYNRPCALY AAPDPFKEEA    300
DKPSTDSKAD TTAMVKLTAD VSSAFFPRFS PDGKFLVFIS AKSAVDSGAH NATNSMHKVD    360
WPADGKLEGS LSVADVVPIV MSPQDGCFPG IYCSGLLRFP WLSDGRTMVL SSVWGSREVI    420
LSVNVASGEV SRVSPLDSDY SWKVLALDNN NILAVSSSLI TQPQMYYGSE SSQTDKSFQW    480
DWQEISSPFP KPSDKVSSLL ADHKFSLLKI PISNPSDKLP DGAKLPFEAI FVSCKDSTSS    540
PTVVVLHGGP HSVYPSSYSK SLAFLYAQGY NLLVVNYRGS LGFGEEALQS LPGNIGSQDV    600
NDVLTALDFV TKRGLIDASR VAVVGGSHGG FLTTHLIGQA PETFVAAAAR NPVCNLSLMV    660
GTTDIPEWCF LEMYGKEGKN CFTESPSAET LAQFYEKSPI SHISKVKTPT LFLLGAKDLR    720
VPVSNGLQYA RTMKERGLET KIIVFPEDNH GLDKPQADYE SFLNIGVWFK KYMSK*        780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG0657Aes4.0e-10519770267+
COG0412COG04128.0e-12520760251+
pfam12697Abhydrolase_65.0e-13543757217+
pfam00326Peptidase_S92.0e-37557775223+
COG1506DAP25.0e-49315775468+
Gene Ontology
GO TermDescription
GO:0006508proteolysis
GO:0008152metabolic process
GO:0008236serine-type peptidase activity
GO:0016787hydrolase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABB47613.10177565839prolyl oligopeptidase family protein, expressed [Oryza sativa (japonica cultivar-group)]
GenBankABB47614.10197741764prolyl oligopeptidase family protein, expressed [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001064602.1017751775Os10g0415600 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001064603.10127744774Os10g0415800 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001151758.101277512774LOC100285393 [Zea mays]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4hxf_B4e-19533751371579A Chain A, Pyrococcus Horikoshii Acylaminoacyl Peptidase (orthorhombic Crystal Form)
PDB4hxe_B4e-19533751371579B Chain B, Pyrococcus Horikoshii Acylaminoacyl Peptidase (uncomplexed)
PDB4hxg_L7e-19533751371579A Chain A, Pyrococcus Horikoshii Acylaminoacyl Peptidase (orthorhombic Crystal Form)
PDB4hxg_K7e-19533751371579A Chain A, Pyrococcus Horikoshii Acylaminoacyl Peptidase (orthorhombic Crystal Form)
PDB4hxg_J7e-19533751371579A Chain A, Pyrococcus Horikoshii Acylaminoacyl Peptidase (orthorhombic Crystal Form)
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO8504863404327710
GO8504843354327660
GT0435283313707000
GO8725903211154340
GO8403243471354800
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00583.4Aquca_017_00583.3Aquca_017_00583.2Aquca_017_00583.1Aquca_015_00163.1
Arabidopsis lyrata915409859721
Arabidopsis thalianaAT4G14570.1AT5G36210.1
Brachypodium distachyonBradi3g26780.3Bradi3g26780.2Bradi3g26787.1Bradi1g45890.1
Brassica rapaBra039731Bra036867Bra037063Bra030822
Capsella rubellaCarubv10006608mCarubv10013057mCarubv10012695mCarubv10013077mCarubv10004231m
Chlamydomonas reinhardtiiCre05.g241650.t1.3Cre10.g423300.t1.1
Citrus clementinaCiclev10004377mCiclev10004325mCiclev10003676m
Citrus sinensisorange1.1g005093morange1.1g004149morange1.1g004141morange1.1g003363morange1.1g004816m
orange1.1g004757morange1.1g004756morange1.1g004735m
Cucumis sativusCucsa.386660.1Cucsa.123480.1Cucsa.123460.1
Eucalyptus grandisEucgr.H00222.1Eucgr.H00221.1Eucgr.F00026.5Eucgr.F00026.4Eucgr.F00026.3
Eucgr.F00026.2Eucgr.F00026.1Eucgr.F00028.1Eucgr.F00027.2Eucgr.F00027.1
Eucgr.L02208.1Eucgr.F00027.3Eucgr.F00025.1
Fragaria vescamrna29072.1-v1.0-hybridmrna32579.1-v1.0-hybridmrna09045.1-v1.0-hybridmrna09044.1-v1.0-hybrid
Glycine maxGlyma10g00350.1Glyma10g00320.1Glyma08g42730.1Glyma18g11480.3Glyma18g11480.2
Glyma18g11480.4
Gossypium raimondiiGorai.006G245500.5Gorai.006G245500.4Gorai.006G245500.3Gorai.006G245500.1Gorai.010G016900.1
Linum usitatissimumLus10039405Lus10015363Lus10032765Lus10021758
Malus domesticaMDP0000211874MDP0000304250MDP0000251803
Manihot esculentacassava4.1_002075mcassava4.1_031105mcassava4.1_005468m
Medicago truncatulaAC233668_48.1Medtr5g042400.2Medtr5g042400.1Medtr5g042410.1Medtr3g051310.1
Mimulus guttatusmgv1a001402mmgv1a001397mmgv1a002403m
Oryza sativaLOC_Os10g28020.3LOC_Os10g28020.1LOC_Os10g28020.2LOC_Os10g28030.2LOC_Os10g28030.1
LOC_Os06g11180.1
Panicum virgatumPavirv00008779mPavirv00061808mPavirv00015591mPavirv00045661mPavirv00003810m
Pavirv00003809m
Physcomitrella patensPp1s619_3V6.1Pp1s97_68V6.1Pp1s108_134V6.1Pp1s9_317V6.2Pp1s9_317V6.1
Pp1s139_36V6.2Pp1s139_36V6.1
Phaseolus vulgarisPhvul.007G279900.1Phvul.007G280000.1Phvul.006G042600.1Phvul.006G042700.1
Populus trichocarpaPotri.008G160400.1Potri.002G128700.9Potri.002G128700.8Potri.002G128700.7Potri.002G128700.6
Potri.002G128700.5Potri.002G128700.4Potri.002G128700.3Potri.002G128700.2Potri.002G128700.10
Potri.002G128700.1
Prunus persicappa001729mppa002365m
Ricinus communis29844.m00318230170.m01392428323.m000042
Setaria italicaSi034264mSi034356mSi006001mSi005937mSi005954m
Selaginella moellendorffii16830378836
Sorghum bicolorSb01g021970.4Sb01g021970.2Sb01g021970.1Sb01g021970.5Sb01g021960.1
Sb01g021970.3Sb10g007280.1Sb10g007270.1
Thellungiella halophilaThhalv10024477mThhalv10003712m
Vitis viniferaGSVIVT01018091001GSVIVT01009564001GSVIVT01009565001
Volvox carteriVocar20006950m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)