y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi3g26787.1
FamilyCE10
Protein PropertiesLength: 764 Molecular Weight: 83463.6 Isoelectric Point: 5.9736
ChromosomeChromosome/Scaffold: 3 Start: 27549069 End: 27553593
Descriptionacylaminoacyl-peptidase-related
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE105107446.2e-27
  DGGQLPFEAIFVSCEDSWQKPTALVLHGGPHSTSVSGYSKSSAFLTSLGFNLLIVNYRGTPGFGEEALQSLPGKVGSQDVQDCLTALDFVIKEGLIDASK
  VAVVGISHGGFLATHLIGQAPDRFAVAAARNPVCNLSLMIGTTDIPDWCYAVACGSEAKIDASETPSLDHLRLFYQKSPVAHISKVKVPLLMLLGGADLR
  VPISNGLQYARALRERGGEIKIMLFSEDIHEINIP
Full Sequence
Protein Sequence     Length: 764     Download
MDGTAPEEYD SQSKLLQEFI CVPSIDSAWF FKTNNGERST AMFSVSQPDL LANNNRKHIL    60
YSHIMRHATN SLECYWSPFP IEMTGVSLVV PSNLGSKLLV VRNGEKGSPT KLQIVDQSHV    120
EKEIHVDQSI HGPLFTDEWF HGVSWNQEET FIAYIAEEPP QPKPAFNDAG YRKEGSSEKD    180
CNTWRGQGGW EEDWGETYCK RGRPSLFVLD IASGQLRAAK GIAKSLSVGQ VVWAPPSSNG    240
YQKNLVFVGW LEHNGFHNTA RKLGIKYCSN RPCSLYAITC PFQEPNADNA SVSGGKSDCS    300
SIATNLTPSI SSAFFPRFSK DGNLLVFLSA KRAVDSGAHN ATDSLHKIKW PVDWNMDEHL    360
GVMDVVPAVM CPLDGCFPGL YCSSMLSDPW LSDQRTMILA SAWRSTQVIL SIDVLSGEVT    420
RISPEGSDYS WTALAVNGNN VLSVSSSPID PPQLSYGRQA ATEDQICGWV WDEVPSPLMA    480
ASNKVKALLS RHKFGILKIP VTQPSDELSD GGQLPFEAIF VSCEDSWQKP TALVLHGGPH    540
STSVSGYSKS SAFLTSLGFN LLIVNYRGTP GFGEEALQSL PGKVGSQDVQ DCLTALDFVI    600
KEGLIDASKV AVVGISHGGF LATHLIGQAP DRFAVAAARN PVCNLSLMIG TTDIPDWCYA    660
VACGSEAKID ASETPSLDHL RLFYQKSPVA HISKVKVPLL MLLGGADLRV PISNGLQYAR    720
ALRERGGEIK IMLFSEDIHE INIPQSDFES FLNIGVWFKK HLK*                     780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG0657Aes8.0e-7530763252+
pfam12695Abhydrolase_51.0e-7531724194+
pfam12697Abhydrolase_61.0e-8533723191+
pfam00326Peptidase_S93.0e-33552763215+
COG1506DAP23.0e-41530763234+
Gene Ontology
GO TermDescription
GO:0006508proteolysis
GO:0008152metabolic process
GO:0008236serine-type peptidase activity
GO:0016787hydrolase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABB47614.1017621763prolyl oligopeptidase family protein, expressed [Oryza sativa (japonica cultivar-group)]
GenBankEAY78482.1017621792hypothetical protein OsI_33574 [Oryza sativa Indica Group]
RefSeqNP_001064603.10176211773Os10g0415800 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001147818.1017621779LOC100281428 [Zea mays]
RefSeqXP_002467246.10176211770hypothetical protein SORBIDRAFT_01g021960 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4hxf_B3e-16530763379605A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group
PDB4hxe_B3e-16530763379605B Chain B, Pyrococcus Horikoshii Acylaminoacyl Peptidase (uncomplexed)
PDB4hxg_L7e-16530763379605A Chain A, Pyrococcus Horikoshii Acylaminoacyl Peptidase (orthorhombic Crystal Form)
PDB4hxg_K7e-16530763379605A Chain A, Pyrococcus Horikoshii Acylaminoacyl Peptidase (orthorhombic Crystal Form)
PDB4hxg_J7e-16530763379605A Chain A, Pyrococcus Horikoshii Acylaminoacyl Peptidase (orthorhombic Crystal Form)
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO8504863404217600
GT8657932313986280
GO85983125812580
GO8504843354217550
GT865793296216490.01
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00583.4Aquca_017_00583.3Aquca_017_00583.2Aquca_017_00583.1Aquca_015_00163.1
Arabidopsis lyrata915409859721
Arabidopsis thalianaAT4G14570.1AT5G36210.1
Brachypodium distachyonBradi3g26780.4Bradi3g26780.3Bradi3g26780.2Bradi1g45890.1
Brassica rapaBra039731Bra036867Bra037063Bra030822
Capsella rubellaCarubv10006608mCarubv10013057mCarubv10012695mCarubv10013077mCarubv10004231m
Chlamydomonas reinhardtiiCre05.g241650.t1.3Cre10.g423300.t1.1
Citrus clementinaCiclev10004377mCiclev10004325mCiclev10003676m
Citrus sinensisorange1.1g005093morange1.1g004149morange1.1g004141morange1.1g003363morange1.1g004816m
orange1.1g004757morange1.1g004756morange1.1g004735m
Cucumis sativusCucsa.386660.1Cucsa.123480.1Cucsa.123460.1
Eucalyptus grandisEucgr.H00222.1Eucgr.H00221.1Eucgr.F00026.5Eucgr.F00026.4Eucgr.F00026.3
Eucgr.F00026.2Eucgr.F00026.1Eucgr.F00028.1Eucgr.F00027.2Eucgr.F00027.1
Eucgr.L02208.1Eucgr.F00027.3Eucgr.F00025.1
Fragaria vescamrna29072.1-v1.0-hybridmrna32579.1-v1.0-hybridmrna09045.1-v1.0-hybridmrna09044.1-v1.0-hybrid
Glycine maxGlyma10g00350.1Glyma10g00320.1Glyma08g42730.1Glyma18g11480.3Glyma18g11480.2
Glyma18g11480.4
Gossypium raimondiiGorai.006G245500.5Gorai.006G245500.4Gorai.006G245500.3Gorai.006G245500.1Gorai.010G016900.1
Linum usitatissimumLus10039405Lus10015363Lus10032765Lus10021758
Malus domesticaMDP0000211874MDP0000304250MDP0000251803
Manihot esculentacassava4.1_002075mcassava4.1_031105mcassava4.1_005468m
Medicago truncatulaAC233668_48.1Medtr5g042400.2Medtr5g042400.1Medtr5g042410.1Medtr3g051310.1
Mimulus guttatusmgv1a001402mmgv1a001397mmgv1a002403m
Oryza sativaLOC_Os10g28020.3LOC_Os10g28020.1LOC_Os10g28020.2LOC_Os10g28030.2LOC_Os10g28030.1
LOC_Os06g11180.1
Panicum virgatumPavirv00008779mPavirv00061808mPavirv00015591mPavirv00045661mPavirv00003810m
Pavirv00003809m
Physcomitrella patensPp1s619_3V6.1Pp1s97_68V6.1Pp1s108_134V6.1Pp1s9_317V6.2Pp1s9_317V6.1
Pp1s139_36V6.2Pp1s139_36V6.1
Phaseolus vulgarisPhvul.007G279900.1Phvul.007G280000.1Phvul.006G042600.1Phvul.006G042700.1
Populus trichocarpaPotri.008G160400.1Potri.002G128700.9Potri.002G128700.8Potri.002G128700.7Potri.002G128700.6
Potri.002G128700.5Potri.002G128700.4Potri.002G128700.3Potri.002G128700.2Potri.002G128700.10
Potri.002G128700.1
Prunus persicappa001729mppa002365m
Ricinus communis29844.m00318230170.m01392428323.m000042
Setaria italicaSi034264mSi034356mSi006001mSi005937mSi005954m
Selaginella moellendorffii16830378836
Sorghum bicolorSb01g021970.4Sb01g021970.2Sb01g021970.1Sb01g021970.5Sb01g021960.1
Sb01g021970.3Sb10g007280.1Sb10g007270.1
Thellungiella halophilaThhalv10024477mThhalv10003712m
Vitis viniferaGSVIVT01018091001GSVIVT01009564001GSVIVT01009565001
Volvox carteriVocar20006950m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)