y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi3g27610.1
FamilyGT1
Protein PropertiesLength: 489 Molecular Weight: 53133.4 Isoelectric Point: 5.5606
ChromosomeChromosome/Scaffold: 3 Start: 28631370 End: 28636339
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT12684661e-36
  PAGFARSAVATSMWAESDCSHWLDAQPPGSVLYISFGSYAHVTKQELHEIAGGVLASGARFLWVMRPDIVSSDDPDPLPEGFVAASAGRGLVVPWCCQVE
  VLSHAAVGAFLTHCGWNSVLESVWAGVPMLCFPLLTDQFTNRRLVAREWRVGVPVGDRGAVFADEVRARIEGVMAGEEGEELRKAVKKVRATLEAAAAP
Full Sequence
Protein Sequence     Length: 489     Download
MAQGESTGVV ARRGGGGKPH AVVVVYPLQG HIIPVTHLAL RLASRGFAVT FVNTEAVHDQ    60
TARALGVDPA GYDVFAGARG EWSSEMDVRY ELVSDGLPVG FDRSLHHDEF MEALFSALSG    120
HVEALLRRVV VDPASTCLVA DTFFVWPATL ARKFGIAYVS FWTEPALIFN LYYHVHLLTN    180
NGHFGCDEPR KDTITYIPGV PAIEPRELMS YLQETDTTTV VHRIIFKAFE EARGADYVLC    240
NTVEELEPST IAALRAEKPF YAVGPIFPAG FARSAVATSM WAESDCSHWL DAQPPGSVLY    300
ISFGSYAHVT KQELHEIAGG VLASGARFLW VMRPDIVSSD DPDPLPEGFV AASAGRGLVV    360
PWCCQVEVLS HAAVGAFLTH CGWNSVLESV WAGVPMLCFP LLTDQFTNRR LVAREWRVGV    420
PVGDRGAVFA DEVRARIEGV MAGEEGEELR KAVKKVRATL EAAAAPGGSS QRSFDQFVDE    480
 LTRRCGGR*                                                           540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN03007PLN030078.0e-6318484504+
PLN02152PLN021521.0e-6419481483+
PLN02173PLN021734.0e-6920481477+
PLN02555PLN025552.0e-9019484479+
PLN02448PLN024481.0e-10420482477+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACN34169.101948421476unknown [Zea mays]
GenBankEAY78678.101548515498hypothetical protein OsI_33780 [Oryza sativa Indica Group]
RefSeqNP_001064696.1034851496Os10g0442300 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002314296.10184888474predicted protein [Populus trichocarpa]
RefSeqXP_002464565.101448713488hypothetical protein SORBIDRAFT_01g020920 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2pq6_A0184848480A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2c9z_A0184837452A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2c1z_A0184837452A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2c1x_A0184837452A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification
PDB2vg8_A0194747460A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification
Metabolic Pathways
Pathway NameReactionECProtein Name
cytokinins-O-glucoside biosynthesisRXN-4723EC-2.4.1.203trans-zeatin O-β-D-glucosyltransferase
cytokinins-O-glucoside biosynthesisRXN-4726EC-2.4.1UDP-glucose:dihydrozeatin O-β-D-glucosyltransferase
cytokinins-O-glucoside biosynthesisRXN-4735EC-2.4.1.215cis-zeatin O-β-D-glucosyltransferase
cytokinins-O-glucoside biosynthesisRXN-4737EC-2.4.1dihydrozeatin-9-N-glucoside O-β-D-glucosyltransferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EG631249465184780
EG3771312642034650
EE172024259873450
EE182757275803520
EE014094269863520
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_030_00088.1
Arabidopsis lyrata321400481703
Arabidopsis thalianaAT2G36970.1AT2G28080.1
Brassica rapaBra034386Bra005227Bra005229
Carica papayaevm.model.supercontig_1.23evm.model.supercontig_1.22
Capsella rubellaCarubv10023101mCarubv10025463m
Citrus clementinaCiclev10011571mCiclev10029902m
Citrus sinensisorange1.1g011789morange1.1g011724m
Cucumis sativusCucsa.385870.1
Eucalyptus grandisEucgr.B02537.1Eucgr.A01691.1
Fragaria vescamrna09620.1-v1.0-hybridmrna28972.1-v1.0-hybridmrna09619.1-v1.0-hybrid
Gossypium raimondiiGorai.003G144500.1
Linum usitatissimumLus10016127Lus10016128Lus10016126Lus10021438Lus10021437
Malus domesticaMDP0000184195MDP0000803674MDP0000148190MDP0000134856MDP0000696804
MDP0000279483MDP0000179216MDP0000128678
Manihot esculentacassava4.1_028045mcassava4.1_006927mcassava4.1_005956m
Mimulus guttatusmgv1a020724mmgv1a005852mmgv1a004928mmgv11b024665mmgv1a005283m
mgv1a005298mmgv1a005487mmgv1a005552mmgv1a023861mmgv1a004868m
mgv1a005354mmgv1a017916mmgv1a005271mmgv1a005954mmgv1a020141m
mgv1a026087mmgv1a019418m
Oryza sativaLOC_Os10g30560.1
Panicum virgatumPavirv00016210m
Picea abiesMA_20g0030MA_617328g0010MA_142317g0010MA_10436196g0010.108.287MA_10436196g0010.108.287
MA_57716g0010MA_10430346g0010MA_10436196g0010.563.731MA_10436196g0010.563.731MA_848089g0010
MA_343701g0010MA_111005g0010MA_10223011g0010MA_173000g0010MA_10281032g0010
MA_10259759g0010MA_10434721g0010MA_10434721g0020MA_10434576g0010MA_8498693g0010
MA_19907g0010MA_10426491g0010MA_220991g0010MA_10433786g0010MA_10108066g0010
MA_42695g0010MA_8452538g0010MA_10349694g0010MA_871006g0010MA_10434904g0020
Populus trichocarpaPotri.004G214100.2Potri.004G214100.1Potri.009G008100.1
Prunus persicappa004816mppa004829mppa020358mppa015843mppa023014m
ppa024090m
Ricinus communis29589.m001229
Setaria italicaSi035348mSi035373m
Sorghum bicolorSb01g020920.1
Thellungiella halophilaThhalv10016590mThhalv10016577mThhalv10017663m
Vitis viniferaGSVIVT01025724001GSVIVT01031515001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)