y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi3g28580.1
FamilyGH116
Protein PropertiesLength: 963 Molecular Weight: 107994 Isoelectric Point: 6.845
ChromosomeChromosome/Scaffold: 3 Start: 29961736 End: 29973090
DescriptionBeta-glucosidase, GBA2 type family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1165459070
  GKFLYLEGVEYIMWNTYDVHFYASFALLDLFPKIELSIQRDFADAVLYEDRRRVKFLADGTSGIRKVKGAVPHDLGTHDPWHEMNAYNIHDTSKWKDLNP
  KFVLQVYRDFAATGDMTFGRDVWPAVCAAMDYMDQFDRDGDGLIENDGFPDQTYDAWTVHGISAYCGCLWLAALQAAATMAHRLGDRPYAEKYKLKFIKA
  KAVYEAKLWNGSYFNYDSGTSSNSRSIQADQLAGQWYAASSGLPPIFDEHKIRSALQKIFEFNVMKVKGGRMGAVNGMTPKGKVDETCMQSREIWTGVTY
  GVAANMLLHGMEHQGFITAEGIFLAGWSEEGYGYWFQTPEGWTTDGHYRSLIYMRPLAIWAMQ
Full Sequence
Protein Sequence     Length: 963     Download
MVSGHLFHCR KNSWPPEEYV GRSALQLLDL DGAAPPEQAW RRRLNSHANI LKEFSVTFME    60
AMKMMSLGVR LWSYVREEAS HGRKAPIDPF TRESCKPSAS QGVPLGGMGS GSISRGFRGE    120
FKNWHIIPGL CENSPVMENQ FSIFVSRDGG NKKCSSVLAP GHHDGLKKYS DSGISSWDWN    180
LSGQHSTYHA LFPRAWTVYD GEPDPDLKIS CRQISPFIPH DYKESSLPTS VFVYTLVNTG    240
RDRAKVSLLM TWANSIGGFS HHSGGHFNEP FIGEDGVSGV LLHHKTAKDN PPVTFAIAAC    300
ETQNVNVTVL PVFGLSGENH VSAKDMWDIM KKDGHFNLEN FNAGCSMPSS PGETLCAAVT    360
ASTWVEPHGR CTVAFALSWS SPKVKFQKGC TYNRRYTEFY GTSERSSINL VHDALTKYRL    420
WEEEIEKWQN PILRDERLPE WYKFTLFNEL YFLVAGGTVW TDGQPPAIDE KTNPASNQQK    480
HSKKPIKDTK SESVKDNLPR PTAEQVFNGD DLTNGGPQMP EQTNGLRVQE PVPCIHSKDG    540
PENVGKFLYL EGVEYIMWNT YDVHFYASFA LLDLFPKIEL SIQRDFADAV LYEDRRRVKF    600
LADGTSGIRK VKGAVPHDLG THDPWHEMNA YNIHDTSKWK DLNPKFVLQV YRDFAATGDM    660
TFGRDVWPAV CAAMDYMDQF DRDGDGLIEN DGFPDQTYDA WTVHGISAYC GCLWLAALQA    720
AATMAHRLGD RPYAEKYKLK FIKAKAVYEA KLWNGSYFNY DSGTSSNSRS IQADQLAGQW    780
YAASSGLPPI FDEHKIRSAL QKIFEFNVMK VKGGRMGAVN GMTPKGKVDE TCMQSREIWT    840
GVTYGVAANM LLHGMEHQGF ITAEGIFLAG WSEEGYGYWF QTPEGWTTDG HYRSLIYMRP    900
LAIWAMQWAL SPPKAILEAP KVNLMDRIHV SPQAARAISE ISIRKIAPDN RCISSSTFQC    960
EC*                                                                  1020
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3408GDB17.0e-561370299+
COG4354COG43544.0e-26102462376+
pfam12215GBA2_N9.0e-60102421334+
COG4354COG43541.0e-68544910385+
pfam04685DUF6083.0e-164545908368+
Gene Ontology
GO TermDescription
GO:0004348glucosylceramidase activity
GO:0006665sphingolipid metabolic process
GO:0016021integral to membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAL31035.1019621967AC078948_19 unknown protein [Oryza sativa Japonica Group]
GenBankEEC67156.1019621974hypothetical protein OsI_34005 [Oryza sativa Indica Group]
GenBankEEE51125.1019621935hypothetical protein OsJ_31868 [Oryza sativa Japonica Group]
RefSeqNP_001064833.1019621974Os10g0473400 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002285674.1019621978PREDICTED: similar to catalytic [Vitis vinifera]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GT0459923396119490
GO8565583386199560
GO8689133315288580
GT0454373181174340
GT045437294294570.00008
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00087.2Aquca_017_00087.1Aquca_034_00116.1
Arabidopsis lyrata331392479911473529327181
Arabidopsis thalianaAT1G33700.2AT1G33700.1AT5G49900.1AT3G24180.2AT3G24180.1
AT4G10060.1
Brachypodium distachyonBradi4g21277.1Bradi3g13487.1Bradi1g28847.1Bradi3g13520.1
Brassica rapaBra014964Bra028008Bra000598Bra028320Bra033199
Carica papayaevm.model.supercontig_59.121evm.model.supercontig_21.79evm.model.supercontig_113.12
Capsella rubellaCarubv10025826mCarubv10012912mCarubv10008221mCarubv10002637m
Citrus clementinaCiclev10004255mCiclev10000199mCiclev10018743mCiclev10018742m
Citrus sinensisorange1.1g039165morange1.1g002202morange1.1g038924m
Cucumis sativusCucsa.266300.2Cucsa.266300.1Cucsa.023010.1Cucsa.237200.1Cucsa.237200.2
Eucalyptus grandisEucgr.I02786.1Eucgr.H02851.2Eucgr.H02851.1Eucgr.H00075.1Eucgr.F02980.1
Eucgr.F02980.2
Fragaria vescamrna29905.1-v1.0-hybridmrna02278.1-v1.0-hybrid
Glycine maxGlyma10g33610.1Glyma20g33990.1Glyma07g40310.2
Gossypium raimondiiGorai.008G046700.1Gorai.011G160300.5Gorai.011G160300.4Gorai.011G160300.3Gorai.011G160300.2
Gorai.011G160300.1Gorai.013G133800.2Gorai.013G133800.1Gorai.006G221200.3Gorai.006G221200.2
Gorai.006G221200.1Gorai.008G046700.3Gorai.008G046700.2.531.722Gorai.008G046700.2.531.722Gorai.008G046700.2.724.851
Gorai.008G046700.2.724.851
Linum usitatissimumLus10000757Lus10003517Lus10002950Lus10023340Lus10038471
Lus10038469
Malus domesticaMDP0000175141MDP0000220028MDP0000128604
Manihot esculentacassava4.1_001108mcassava4.1_002224mcassava4.1_003299mcassava4.1_005809m
Medicago truncatulaMedtr1g072720.1Medtr1g072680.1
Mimulus guttatusmgv1a000876mmgv1a000873m
Oryza sativaLOC_Os10g33420.1LOC_Os11g13810.1LOC_Os08g01940.2LOC_Os08g01940.1LOC_Os07g26210.1
LOC_Os07g26210.2
Panicum virgatumPavirv00047844mPavirv00042892mPavirv00041095mPavirv00002207mPavirv00050055m
Pavirv00014420mPavirv00035631mPavirv00038108m
Physcomitrella patensPp1s134_55V6.1Pp1s40_202V6.1
Phaseolus vulgarisPhvul.007G134300.1Phvul.003G075400.1
Picea abiesMA_10430605g0020MA_10431145g0020MA_61180g0010MA_35878g0010MA_10426003g0020.110.198
MA_10426003g0020.110.198MA_165077g0010
Populus trichocarpaPotri.T163400.1Potri.019G072800.2Potri.019G072800.1Potri.004G227200.4Potri.004G227200.2
Potri.004G227200.1Potri.003G178000.4Potri.003G178000.3Potri.003G178000.2Potri.003G178000.1
Potri.003G003400.1Potri.003G003400.2Potri.019G072800.3Potri.004G227200.3Potri.003G003400.3
Prunus persicappa001012mppa000954m
Ricinus communis29685.m00048429757.m00075229904.m002967
Setaria italicaSi034088mSi026057mSi025923mSi029270mSi028945m
Si028854mSi013210mSi026013m
Selaginella moellendorffii16663492385
Sorghum bicolorSb01g019510.2Sb01g019510.1Sb05g007160.1Sb0073s002050.1Sb07g001140.1
Thellungiella halophilaThhalv10006714mThhalv10012588mThhalv10020003mThhalv10020001m
Vitis viniferaGSVIVT01036381001GSVIVT01023217001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)