y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi3g28605.1
FamilyGT24
Protein PropertiesLength: 1609 Molecular Weight: 181664 Isoelectric Point: 5.6986
ChromosomeChromosome/Scaffold: 3 Start: 30000665 End: 30021194
DescriptionUDP-glucose:glycoprotein glucosyltransferases;transferases, transferring hexosyl groups;transferases, transferring glycosyl groups
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT24130415510
  INIFSVASGHLYERFLKIMILSVLKKTQRPVKFWFIKNYLSPQFKDVIPHMAQEYGFGYELITYKWPTWLHKQKEKQRIIWAYKILFLDVIFPLSLRKVI
  FVDADQIVRTDMGELYDMNLKGRPLAYTPFCDNNKEMDGYRFWKQGFWKDHLRGRPYHISALYVVDLAKFRQTAAGDTLRVVYETLSKDPNSLSNLDQDL
  PNYAQHTVPIFSLPQEWLWCESWCGNATKARAKTIDLCNNPMTKEPKL
Full Sequence
Protein Sequence     Length: 1609     Download
MAAARGSRSG VSGAALALLA AVLVGCLAGG ASAAEIRRQK NVQVALRAKW AGTPLLLEAN    60
ELLSKEGKDL FWGFVDHWKE LDKGSECLTA KCCVQKIVED VHSLIGEPLA SIFEFSLTLR    120
SASPRLVLYR QLAEESLSSV PVEDDALEQI SGHGPVEGTC CWVDTGSALL FNSADLHKWL    180
EGSGKRTMDS TGQPELFDFD HVYPRSNVTA PVAILYGAVG TKCFKELHVR LAEASKKGKV    240
RYALRPVLPS GCQATSSFCA SIGAVDAVTL SGYGVELALK NMEYKAMDDT AIKKGVALED    300
PKTEDLGQEV RGFIFSKILE RKPELNDEAM AFRDYLLSST VSDTLEVWEL KDLGHQTAQR    360
ILHASDPLQS MQEINQNFPS VVSSLSRMKL DDSIKDEIIA NQRMVPPGKS LMALNGALIN    420
IEDLDLYLLM DMVREELSLA DQFIRLKLPK SAVHKILSAA PPAESNSFRV DFRASHVHYL    480
NNLEEDDLYK RWRSNLNELL MPVYPGQMRY IRKNLFHAVY VLDPASACGA ETIDTIMSLY    540
QDSVPVRFGI IMYSSRFINV IEENDGTHQV NDGSKSEDDT STLIIRLFLY IKETYSTQLA    600
FEFLSNIHKL RNGGDDYSEE PVEAHHVEEA FVDSVLSGAK SHPQDVLLKL QKENMYKQEA    660
EENSRFVHKL GLYKLHCCLL MNGLVHESNE DATMNAMNDE LPRIQEQVYY GHIQSHTDVL    720
EKFLSESSYK RYNPSITGKS TEKKRFVSLF ASYHQEDSVL HDINYLHSDG TTDDVKPVTH    780
LLAVDLSSKI GTKLLHEAIC YLMDGSNRAR VGLLLYARSD SASNILLMKD IIDRTISSFS    840
DKEKVLGFLH GFCKFYESQH MPASTAVGDR ISPMMDEVYN LAAETDLPVD DYKSWLASFS    900
ADTVLKRIDK LNDFLFGQLG LEFGSNAVIT NGRIFVVGVG DSFLTDDLGL LESMEYELRT    960
KYIHEIVEEV EWAGVDPDYL TSKFYSDITM LVSSSMSVRE RPSERAHFEI LHAEHSAIKL    1020
NYMNSSIHID AVIDPLSPAG QKLSPLLRIL WRQIQPSMRI VLNPISSLAD LPLKNYYRFV    1080
LPSMDDFSNT DYSVHGPKAF FSNMPLSKTL TMNIDVPEPW LVEPVVAIHD LDNILLENLG    1140
DVRTLQAVFE LEALLLTGHC MEKDREPPRG LQFILGTKQM PHLVDTLVMA NLGYWQMKVS    1200
PGVWYLQLAP GRSADLYELP SKLIAIDSLR GKLIHIEVQK KKGKEHEDLL NADDENHFQE    1260
KMDNKGWNSN LLKWASSFIS GDASLKKKSE KINDLKDARQ GETINIFSVA SGHLYERFLK    1320
IMILSVLKKT QRPVKFWFIK NYLSPQFKDV IPHMAQEYGF GYELITYKWP TWLHKQKEKQ    1380
RIIWAYKILF LDVIFPLSLR KVIFVDADQI VRTDMGELYD MNLKGRPLAY TPFCDNNKEM    1440
DGYRFWKQGF WKDHLRGRPY HISALYVVDL AKFRQTAAGD TLRVVYETLS KDPNSLSNLD    1500
QDLPNYAQHT VPIFSLPQEW LWCESWCGNA TKARAKTIDL CNNPMTKEPK LQGARRIVPE    1560
WVDFDSEARQ FTARILGENL ESAEATSVPS DAPKPDDKDS RQDVKDEL*                1620
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam01501Glyco_transf_80.000613081503203+
cd04194GT8_A4GalT_like3.0e-1313041520226+
cd00505Glyco_transf_88.0e-5713041551257+
pfam06427UDP-g_GGTase1.0e-829861191212+
cd06432GT8_HUGT1_C_like4.0e-17313041551248+
Gene Ontology
GO TermDescription
GO:0003980UDP-glucose:glycoprotein glucosyltransferase activity
GO:0006486protein glycosylation
GO:0016757transferase activity, transferring glycosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAD28382.101160311624putative UDP-glucose:glycoprotein glucosyltransferase [Oryza sativa Japonica Group]
GenBankEEC73742.101131211309hypothetical protein OsI_08377 [Oryza sativa Indica Group]
GenBankEEE57527.101160311595hypothetical protein OsJ_07839 [Oryza sativa Japonica Group]
RefSeqXP_002268972.10221604131611PREDICTED: similar to EBS1 (EMS-MUTAGENIZED BRI1 SUPPRESSOR 1); UDP-glucose:glycoprotein glucosyltransferase/ transferase, transferring glycosyl groups / transferase, transferring hexosyl groups [Vitis vinifera]
RefSeqXP_002454743.101160811568hypothetical protein SORBIDRAFT_04g036540 [Sorghum bicolor]
Transmembrane Domains
StartEnd
1234
Signal Peptide
Cleavage Site
33
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO883503323126515870
HO415354556105715880
HO797114337124515810
FG395906283126315450
HO41535414191910582e-17
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_023_00011.1
Arabidopsis lyrata894960
Arabidopsis thalianaAT1G71220.2AT1G71220.1
Brassica rapaBra016154
Capsella rubellaCarubv10022452m
Chlamydomonas reinhardtiig5108.t1g5108.t2
Citrus clementinaCiclev10000024m
Citrus sinensisorange1.1g001078morange1.1g000334morange1.1g000842morange1.1g001779morange1.1g000402m
orange1.1g000446morange1.1g000445m
Cucumis sativusCucsa.033020.2Cucsa.033020.1
Eucalyptus grandisEucgr.H01580.1Eucgr.I02739.1Eucgr.H01552.1.95.175Eucgr.H01552.1.95.175
Fragaria vescamrna11048.1-v1.0-hybrid
Glycine maxGlyma20g20260.1Glyma05g30230.1Glyma08g20020.1Glyma08g20020.2Glyma08g13400.1
Gossypium raimondiiGorai.012G151700.5Gorai.008G027900.1Gorai.012G151700.3Gorai.012G151700.2Gorai.012G151700.4
Linum usitatissimumLus10019946Lus10015475
Malus domesticaMDP0000231077MDP0000439201
Manihot esculentacassava4.1_000150m
Medicago truncatulaMedtr2g006960.1
Mimulus guttatusmgv1a000151m
Oryza sativaLOC_Os02g44510.3LOC_Os02g44510.2LOC_Os02g44510.1
Panicum virgatumPavirv00007561mPavirv00061408m
Physcomitrella patensPp1s25_65V6.1
Phaseolus vulgarisPhvul.006G215600.1
Picea abiesMA_10435601g0010
Populus trichocarpaPotri.003G018900.1
Prunus persicappa000323m
Ricinus communis29222.m000396
Setaria italicaSi033881m
Selaginella moellendorffii186368
Sorghum bicolorSb04g036540.1
Thellungiella halophilaThhalv10018004m
Vitis viniferaGSVIVT01022867001
Volvox carteriVocar20012786m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny