y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi3g29797.1
FamilyGH27
Protein PropertiesLength: 403 Molecular Weight: 44324.1 Isoelectric Point: 5.2677
ChromosomeChromosome/Scaffold: 3 Start: 31833659 End: 31836386
Descriptionalpha-galactosidase 1
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH271342332.6e-31
  AKAQPGSLGYEEQDAKTFASWGVDYLKYDNCNNGDLKPLERYPEMSKALMKAGHPIYFSICEWGDMHPARWAAAYGNSWRTTNDIEDTWDSMTSRADQNE
GH27121361.9e-34
  VAAVGEAKVVHVGEAHRRSMLANGLGSTPPMGWNSWNHFGCDGNGEVVIRETADALISTGLAAAGYRYVNLDDCWAESERDAKGNLVAKKSTFPNGIKAL
  ADYVHSKGLKLGIYSDAGYKTCAKA
Full Sequence
Protein Sequence     Length: 403     Download
MPMLLLVVLA SVAAVGEAKV VHVGEAHRRS MLANGLGSTP PMGWNSWNHF GCDGNGEVVI    60
RETADALIST GLAAAGYRYV NLDDCWAESE RDAKGNLVAK KSTFPNGIKA LADYVHSKGL    120
KLGIYSDAGY KTCAKAQPGS LGYEEQDAKT FASWGVDYLK YDNCNNGDLK PLERYPEMSK    180
ALMKAGHPIY FSICEWGDMH PARWAAAYGN SWRTTNDIED TWDSMTSRAD QNEVWAEYAR    240
PGGWNDPDML EVGNGGMTND EYIVHFSIWA ISKAPLIIGC DVRHMSQDTY DILANTEVIA    300
VNQDPLGVQG KKVRMEGSNE IWAAPLSGYR TAVVLLNRHA KDEAEITARW DDIGLPAGMA    360
VEARDLWQHK TLDAKFTDKM PFNVTPHAAR MFLLTPLTSQ IN*                      420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN03231PLN032313.0e-2240307354+
pfam02065Melibiase3.0e-2227197216+
PLN02229PLN022293.0e-17529399374+
PLN02692PLN02692025398374+
PLN02808PLN02808025397373+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAG13536.101940026410AC023240_9 putative alpha-galactosidase [Oryza sativa Japonica Group]
GenBankACF78913.101939632409unknown [Zea mays]
EMBLCAF34023.1013978404alpha-galactosidase 1 [Pisum sativum]
RefSeqNP_001147362.102239633407alpha-galactosidase [Zea mays]
RefSeqXP_002467021.10439612404hypothetical protein SORBIDRAFT_01g018410 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1uas_A0323961361A Chain A, Crystal Structure Of Rice Alpha-Galactosidase
PDB3a5v_A0343923388A Chain A, Crystal Structure Of Alpha-Galactosidase I From Mortierella Vinacea
PDB1ktc_A0323961386A Chain A, Crystal Structure Of Alpha-Galactosidase I From Mortierella Vinacea
PDB1ktb_A0323961386A Chain A, The Structure Of Alpha-N-Acetylgalactosaminidase
PDB3s5z_B0323391326A Chain A, The Structure Of Alpha-N-Acetylgalactosaminidase
Metabolic Pathways
Pathway NameReactionECProtein Name
ajugose biosynthesis II (galactinol-independent)RXN-8285EC-2.4.1ajugose synthase
ajugose biosynthesis II (galactinol-independent)RXN-8286EC-2.4.1verbascose synthase
ajugose biosynthesis II (galactinol-independent)RXN-8287EC-2.4.1stachyose synthase
melibiose degradationALPHAGALACTOSID-RXNEC-3.2.1.22α-galactosidase
stachyose degradationRXN-11501EC-3.2.1.22α-galactosidase
Signal Peptide
Cleavage Site
18
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EE590887283183000
BQ483923261252850
HO1738562541504030
DV4830112271553810
ES2919392491193670
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_035_00014.1.115.213Aquca_035_00014.1.115.213Aquca_035_00017.3.116.213Aquca_035_00017.3.116.213Aquca_035_00017.2.150.247
Aquca_035_00017.2.150.247Aquca_035_00017.2.150.247Aquca_035_00016.2.157.253Aquca_035_00016.2.157.253Aquca_035_00016.2.157.253
Aquca_035_00017.1.155.353Aquca_035_00017.1.155.353Aquca_035_00016.1.156.346Aquca_035_00016.1.156.346Aquca_005_00148.7.152.256
Aquca_005_00148.7.152.256Aquca_005_00148.2.152.255Aquca_005_00148.2.152.255Aquca_005_00148.2.152.255Aquca_005_00148.1.152.255
Aquca_005_00148.1.152.255Aquca_005_00148.1.152.255Aquca_005_00148.6.155.296Aquca_005_00148.6.155.296Aquca_005_00148.5.155.296
Aquca_005_00148.5.155.296Aquca_005_00148.3.152.336Aquca_005_00148.3.152.336Aquca_005_00148.4.152.253Aquca_005_00148.4.152.253
Aquca_005_00148.4.152.253Aquca_035_00014.1.217.310Aquca_035_00014.1.217.310Aquca_005_00148.2.251.360Aquca_005_00148.2.251.360
Aquca_005_00148.2.251.360Aquca_005_00148.1.251.360Aquca_005_00148.1.251.360Aquca_005_00148.1.251.360Aquca_035_00017.3.219.313
Aquca_035_00017.3.219.313Aquca_035_00017.2.253.347Aquca_035_00017.2.253.347Aquca_035_00017.2.253.347Aquca_005_00148.4.251.336
Aquca_005_00148.4.251.336Aquca_005_00148.4.251.336Aquca_035_00016.2.256.333Aquca_035_00016.2.256.333Aquca_035_00016.2.256.333
Arabidopsis lyrata487670.132.230487670.132.230487670.132.230487672.153.249487672.153.249
487672.153.249486071.153.255486071.153.255486071.153.255486071.262.359
486071.262.359486071.262.359487672.246.349487672.246.349487672.246.349
487670.224.310487670.224.310487670.224.310
Arabidopsis thalianaAT5G08370.2.108.206AT5G08370.2.108.206AT5G08370.2.108.206AT5G08370.1.134.232AT5G08370.1.134.232
AT5G08370.1.134.232AT5G08380.1.150.245AT5G08380.1.150.245AT5G08380.1.150.245AT3G56310.2.139.238
AT3G56310.2.139.238AT3G56310.1.163.262AT3G56310.1.163.262AT3G56310.1.163.262AT3G56310.2.243.345
AT3G56310.2.243.345AT3G56310.1.269.369AT3G56310.1.269.369AT3G56310.1.269.369AT5G08370.2.199.288
AT5G08370.2.199.288AT5G08370.2.199.288AT5G08370.1.226.314AT5G08370.1.226.314AT5G08370.1.226.314
AT5G08380.1.243.326AT5G08380.1.243.326AT5G08380.1.243.326
Brachypodium distachyonBradi1g17730.1.152.256Bradi1g17730.1.152.256Bradi1g17730.1.152.256Bradi3g29797.1.134.233Bradi3g29797.1.134.233
Bradi3g29810.4.152.250Bradi3g29810.4.152.250Bradi3g29810.4.152.250Bradi3g29810.3.152.250Bradi3g29810.3.152.250
Bradi3g29810.1.152.250Bradi3g29810.1.152.250Bradi3g29810.1.152.250Bradi3g29810.2.152.290Bradi3g29810.2.152.290
Bradi3g29810.4.254.330Bradi3g29810.4.254.330Bradi3g29810.4.254.330Bradi3g29810.1.254.330Bradi3g29810.1.254.330
Bradi3g29810.1.254.330Bradi1g17730.1.248.336Bradi1g17730.1.248.336Bradi1g17730.1.248.336
Brassica rapaBra028661.132.230Bra028661.132.230Bra028661.132.230Bra028660.155.346Bra028660.155.346
Bra007235.151.360Bra007235.151.360Bra028661.235.312Bra028661.235.312Bra028661.235.312
Bra005988
Carica papayaevm.model.supercontig_774.1.150.246evm.model.supercontig_774.1.150.246evm.model.supercontig_27.80.154.251evm.model.supercontig_27.80.154.251evm.model.supercontig_27.80.154.251
evm.model.supercontig_27.80.242.352evm.model.supercontig_27.80.242.352evm.model.supercontig_27.80.242.352
Capsella rubellaCarubv10002899m.108.205Carubv10002899m.108.205Carubv10002899m.108.205Carubv10003074m.132.229Carubv10003074m.132.229
Carubv10003074m.132.229Carubv10018370m.138.237Carubv10018370m.138.237Carubv10018370m.242.343Carubv10018370m.242.343
Carubv10003074m.228.322Carubv10003074m.228.322Carubv10003074m.228.322Carubv10002899m.207.288Carubv10002899m.207.288
Carubv10002899m.207.288
Chlamydomonas reinhardtiiCre01.g026250.t1.2
Citrus clementinaCiclev10034010mCiclev10034006mCiclev10033997m
Citrus sinensisorange1.1g038817morange1.1g014862m.157.253orange1.1g014862m.157.253orange1.1g014862m.157.253orange1.1g039407m.130.233
orange1.1g039407m.130.233orange1.1g014963m.150.253orange1.1g014963m.150.253orange1.1g015338m.178.282orange1.1g015338m.178.282
orange1.1g015338m.178.282orange1.1g012852m.176.281orange1.1g012852m.176.281orange1.1g012852m.176.281orange1.1g016207m.178.362
orange1.1g016207m.178.362orange1.1g040445morange1.1g012852m.286.387orange1.1g012852m.286.387orange1.1g012852m.286.387
orange1.1g015338m.278.369orange1.1g015338m.278.369orange1.1g015338m.278.369orange1.1g014862m.256.333orange1.1g014862m.256.333
orange1.1g014862m.256.333orange1.1g044794m
Cucumis sativusCucsa.281070.1.153.249Cucsa.281070.1.153.249Cucsa.281070.1.153.249Cucsa.144010.1.173.374Cucsa.144010.1.173.374
Cucsa.144010.2.153.253Cucsa.144010.2.153.253Cucsa.144010.2.153.253Cucsa.144010.2.262.354Cucsa.144010.2.262.354
Cucsa.144010.2.262.354Cucsa.281070.1.254.332Cucsa.281070.1.254.332Cucsa.281070.1.254.332
Eucalyptus grandisEucgr.G02615.1.108.204Eucgr.G02615.1.108.204Eucgr.H00669.3.156.254Eucgr.H00669.3.156.254Eucgr.H00669.3.156.254
Eucgr.H00669.2.156.254Eucgr.H00669.2.156.254Eucgr.H00669.2.156.254Eucgr.H00669.1.156.254Eucgr.H00669.1.156.254
Eucgr.H00669.1.156.254Eucgr.H00669.4.156.325Eucgr.H00669.4.156.325Eucgr.H00669.5Eucgr.J00326.1.160.256
Eucgr.J00326.1.160.256Eucgr.J00326.1.160.256Eucgr.J00325.1.159.254Eucgr.J00325.1.159.254Eucgr.J00325.1.159.254
Eucgr.J00127.2.156.339Eucgr.J00127.2.156.339Eucgr.J00127.1.156.339Eucgr.J00127.1.156.339Eucgr.J00127.4.157.255
Eucgr.J00127.4.157.255Eucgr.G03128.2.155.259Eucgr.G03128.2.155.259Eucgr.G03128.2.155.259Eucgr.G03128.1.155.364
Eucgr.G03128.1.155.364Eucgr.J00127.3.156.242Eucgr.J00127.3.156.242Eucgr.J00127.3.156.242Eucgr.H00669.6.101.190
Eucgr.H00669.6.101.190Eucgr.H00669.3.258.347Eucgr.H00669.3.258.347Eucgr.H00669.3.258.347Eucgr.H00669.2.258.347
Eucgr.H00669.2.258.347Eucgr.H00669.2.258.347Eucgr.G03128.2.261.364Eucgr.G03128.2.261.364Eucgr.G03128.2.261.364
Eucgr.J00127.3.249.326Eucgr.J00127.3.249.326Eucgr.J00127.3.249.326Eucgr.G02615.1.208.286Eucgr.G02615.1.208.286
Eucgr.D00664.1.178.295Eucgr.D00664.1.178.295Eucgr.H00669.1.258.334Eucgr.H00669.1.258.334Eucgr.H00669.1.258.334
Eucgr.J00326.1.259.337Eucgr.J00326.1.259.337Eucgr.J00326.1.259.337Eucgr.J00325.1.247.336Eucgr.J00325.1.247.336
Eucgr.J00325.1.247.336
Fragaria vescamrna27498.1-v1.0-hybrid.146.242mrna27498.1-v1.0-hybrid.146.242mrna00767.1-v1.0-hybrid.163.261mrna00767.1-v1.0-hybrid.163.261mrna21333.1-v1.0-hybrid.153.358
mrna21333.1-v1.0-hybrid.153.358mrna12197.1-v1.0-hybrid.364.493mrna12197.1-v1.0-hybrid.364.493mrna27498.1-v1.0-hybrid.246.322mrna27498.1-v1.0-hybrid.246.322
Glycine maxGlyma09g28920.1.164.264Glyma09g28920.1.164.264Glyma09g28920.1.164.264Glyma16g33510.1.162.343Glyma16g33510.1.162.343
Glyma10g31765.2.95.193Glyma10g31765.2.95.193Glyma10g31765.1.158.258Glyma10g31765.1.158.258Glyma10g31765.1.158.258
Glyma20g35850.2.157.256Glyma20g35850.2.157.256Glyma20g35850.2.157.256Glyma20g35850.1.94.193Glyma20g35850.1.94.193
Glyma10g31780.1.147.326Glyma10g31780.1.147.326Glyma18g44820.1.149.246Glyma18g44820.1.149.246Glyma18g44820.1.149.246
Glyma09g40990.1.149.246Glyma09g40990.1.149.246Glyma09g40990.1.149.246Glyma18g44820.2.149.325Glyma18g44820.2.149.325
Glyma16g34640.2.155.253Glyma16g34640.2.155.253Glyma06g14920.3.154.361Glyma06g14920.3.154.361Glyma06g14920.2.154.361
Glyma06g14920.2.154.361Glyma06g14920.1.154.361Glyma06g14920.1.154.361Glyma09g28920.1.268.359Glyma09g28920.1.268.359
Glyma09g28920.1.268.359Glyma20g35850.2.247.336Glyma20g35850.2.247.336Glyma20g35850.2.247.336Glyma20g35850.1.184.273
Glyma20g35850.1.184.273Glyma09g40990.1.250.326Glyma09g40990.1.250.326Glyma09g40990.1.250.326Glyma10g31765.1.250.338
Glyma10g31765.1.250.338Glyma10g31765.1.250.338Glyma10g31765.2.188.273Glyma10g31765.2.188.273Glyma18g44820.1.250.326
Glyma18g44820.1.250.326Glyma18g44820.1.250.326
Gossypium raimondiiGorai.012G136800.1.137.233Gorai.012G136800.1.137.233Gorai.012G136800.1.137.233Gorai.013G066400.1.146.246Gorai.013G066400.1.146.246
Gorai.013G066400.1.146.246Gorai.005G214100.1.134.234Gorai.005G214100.1.134.234Gorai.005G214100.1.134.234Gorai.011G025100.6.145.242
Gorai.011G025100.6.145.242Gorai.011G025100.3.145.242Gorai.011G025100.3.145.242Gorai.011G025100.3.145.242Gorai.011G025100.2.145.242
Gorai.011G025100.2.145.242Gorai.011G025100.2.145.242Gorai.011G025100.5.145.241Gorai.011G025100.5.145.241Gorai.011G025100.4.143.239
Gorai.011G025100.4.143.239Gorai.011G025100.4.143.239Gorai.011G025100.1.186.282Gorai.011G025100.1.186.282Gorai.011G025100.1.186.282
Gorai.011G207400.3.143.350Gorai.011G207400.3.143.350Gorai.011G207400.1.162.262Gorai.011G207400.1.162.262Gorai.011G207400.1.162.262
Gorai.009G170600.1.145.234Gorai.009G170600.1.145.234Gorai.011G207400.2.162.228Gorai.011G207400.2.162.228Gorai.011G207400.2.162.228
Gorai.011G207400.1.258.369Gorai.011G207400.1.258.369Gorai.011G207400.1.258.369Gorai.011G207400.2.237.341Gorai.011G207400.2.237.341
Gorai.011G207400.2.237.341Gorai.013G066400.1.249.341Gorai.013G066400.1.249.341Gorai.013G066400.1.249.341Gorai.011G025100.1.275.363
Gorai.011G025100.1.275.363Gorai.011G025100.1.275.363Gorai.011G025100.4.232.317Gorai.011G025100.4.232.317Gorai.011G025100.4.232.317
Gorai.011G025100.3.234.319Gorai.011G025100.3.234.319Gorai.011G025100.3.234.319Gorai.011G025100.2.234.319Gorai.011G025100.2.234.319
Gorai.011G025100.2.234.319Gorai.005G214100.1.234.310Gorai.005G214100.1.234.310Gorai.005G214100.1.234.310Gorai.012G136800.1.237.313
Gorai.012G136800.1.237.313Gorai.012G136800.1.237.313
Linum usitatissimumLus10018260.146.242Lus10018260.146.242Lus10018260.146.242Lus10038325.146.242Lus10038325.146.242
Lus10024401.145.242Lus10024401.145.242Lus10040650Lus10018258.107.205Lus10018258.107.205
Lus10010160Lus10038305.125.221Lus10038305.125.221Lus10036176.125.220Lus10036176.125.220
Lus10029046.152.255Lus10029046.152.255Lus10029046.152.255Lus10034218.193.395Lus10034218.193.395
Lus10018258.204.304Lus10018258.204.304Lus10024401.246.336Lus10024401.246.336Lus10029046.258.355
Lus10029046.258.355Lus10029046.258.355Lus10038325.242.337Lus10038325.242.337Lus10018260.246.336
Lus10018260.246.336Lus10018260.246.336Lus10017365
Malus domesticaMDP0000186122MDP0000880784MDP0000213588MDP0000841170.154.257MDP0000841170.154.257
MDP0000841170.154.257MDP0000274090.170.260MDP0000274090.170.260MDP0000173635.107.197MDP0000173635.107.197
MDP0000802026MDP0000173635.189.298MDP0000173635.189.298MDP0000274090.257.361MDP0000274090.257.361
MDP0000841170.257.359MDP0000841170.257.359MDP0000841170.257.359
Manihot esculentacassava4.1_023135m.145.242cassava4.1_023135m.145.242cassava4.1_023135m.145.242cassava4.1_011258mcassava4.1_027727m.135.230
cassava4.1_027727m.135.230cassava4.1_008949m.142.238cassava4.1_008949m.142.238cassava4.1_008949m.142.238cassava4.1_007792m.166.265
cassava4.1_007792m.166.265cassava4.1_007792m.166.265cassava4.1_023135m.245.338cassava4.1_023135m.245.338cassava4.1_023135m.245.338
cassava4.1_007792m.273.373cassava4.1_007792m.273.373cassava4.1_007792m.273.373cassava4.1_027727m.234.330cassava4.1_027727m.234.330
cassava4.1_008949m.237.316cassava4.1_008949m.237.316cassava4.1_008949m.237.316
Medicago truncatulaMedtr6g069140.1.159.338Medtr6g069140.1.159.338
Mimulus guttatusmgv1a009843mmgv1a007981m.122.227mgv1a007981m.122.227mgv1a007643m.140.236mgv1a007643m.140.236
mgv1a007693m.138.234mgv1a007693m.138.234mgv1a025145m.139.314mgv1a025145m.139.314mgv1a006885m.150.251
mgv1a006885m.150.251mgv1a006885m.150.251mgv1a006885m.247.351mgv1a006885m.247.351mgv1a006885m.247.351
Oryza sativaLOC_Os07g48160.1.152.253LOC_Os07g48160.1.152.253LOC_Os07g48160.1.152.253LOC_Os10g35070.1.141.240LOC_Os10g35070.1.141.240
LOC_Os10g35070.2LOC_Os10g35070.4.141.280LOC_Os10g35070.4.141.280LOC_Os10g35110.2.160.257LOC_Os10g35110.2.160.257
LOC_Os10g35110.2.160.257LOC_Os10g35110.1.160.257LOC_Os10g35110.1.160.257LOC_Os10g35110.1.160.257LOC_Os10g35110.3.84.180
LOC_Os10g35110.3.84.180LOC_Os10g35110.2.261.352LOC_Os10g35110.2.261.352LOC_Os10g35110.2.261.352LOC_Os10g35110.1.261.352
LOC_Os10g35110.1.261.352LOC_Os10g35110.1.261.352LOC_Os10g35110.3.185.277LOC_Os10g35110.3.185.277LOC_Os07g26900.1.90.193
LOC_Os07g26900.1.90.193LOC_Os07g48160.1.244.333LOC_Os07g48160.1.244.333LOC_Os07g48160.1.244.333
Panicum virgatumPavirv00032797m.140.238Pavirv00032797m.140.238Pavirv00070433mPavirv00065332mPavirv00020784m.139.334
Pavirv00020784m.139.334Pavirv00024916m.34.135Pavirv00024916m.34.135Pavirv00024915m.66.166Pavirv00024915m.66.166
Pavirv00005723mPavirv00020382m.136.233Pavirv00020382m.136.233Pavirv00040818mPavirv00035760m.137.235
Pavirv00035760m.137.235Pavirv00056423mPavirv00056422mPavirv00001867mPavirv00058358m
Pavirv00035760m.239.315Pavirv00035760m.239.315Pavirv00024916m.126.212Pavirv00024916m.126.212Pavirv00024915m.158.243
Pavirv00024915m.158.243Pavirv00033636m
Physcomitrella patensPp1s19_295V6.1.172.271Pp1s19_295V6.1.172.271Pp1s19_295V6.1.172.271Pp1s19_295V6.1.281.377Pp1s19_295V6.1.281.377
Pp1s19_295V6.1.281.377
Phaseolus vulgarisPhvul.004G135800.1.163.341Phvul.004G135800.1.163.341Phvul.008G081100.1.150.247Phvul.008G081100.1.150.247Phvul.008G081100.1.150.247
Phvul.010G058400.1Phvul.009G142100.1.156.259Phvul.009G142100.1.156.259Phvul.009G142100.1.156.259Phvul.009G142100.1.259.365
Phvul.009G142100.1.259.365Phvul.009G142100.1.259.365Phvul.008G081100.1.251.340Phvul.008G081100.1.251.340Phvul.008G081100.1.251.340
Picea abiesMA_179817g0010.116.223MA_179817g0010.116.223MA_179817g0010.116.223MA_41308g0010.133.231MA_41308g0010.133.231
MA_41308g0010.133.231MA_54403g0020.133.232MA_54403g0020.133.232MA_54403g0020.133.232MA_10428107g0010.284.461
MA_10428107g0010.284.461MA_10428107g0010.284.461MA_92663g0010.132.309MA_92663g0010.132.309MA_92663g0010.132.309
MA_92663g0010.132.309MA_92663g0010.358.456MA_92663g0010.358.456MA_92663g0010.358.456MA_92663g0010.358.456
MA_96852g0010.141.338MA_96852g0010.141.338MA_327657g0010MA_426361g0010MA_41308g0010.236.328
MA_41308g0010.236.328MA_41308g0010.236.328MA_92663g0010.460.552MA_92663g0010.460.552MA_92663g0010.460.552
MA_92663g0010.460.552MA_54403g0020.236.326MA_54403g0020.236.326MA_54403g0020.236.326MA_179817g0010.228.305
MA_179817g0010.228.305MA_179817g0010.228.305MA_10060779g0010MA_20073g0020MA_10149423g0010
Populus trichocarpaPotri.010G118200.1.145.244Potri.010G118200.1.145.244Potri.010G118200.1.145.244Potri.018G152200.3.170.366Potri.018G152200.3.170.366
Potri.018G152200.2.170.351Potri.018G152200.2.170.351Potri.018G152200.1.170.370Potri.018G152200.1.170.370Potri.010G255200.3
Potri.010G255200.1.165.262Potri.010G255200.1.165.262Potri.010G255200.4Potri.010G255200.2Potri.004G038100.3.146.320
Potri.004G038100.3.146.320Potri.004G038100.1.148.322Potri.004G038100.1.148.322Potri.004G038100.2.145.239Potri.004G038100.2.145.239
Potri.004G038100.2.145.239Potri.019G056700.2.160.261Potri.019G056700.2.160.261Potri.019G056700.2.160.261Potri.019G056700.1.160.261
Potri.019G056700.1.160.261Potri.019G056700.1.160.261Potri.019G056700.2.264.369Potri.019G056700.2.264.369Potri.019G056700.2.264.369
Potri.019G056700.1.264.369Potri.019G056700.1.264.369Potri.019G056700.1.264.369Potri.010G118200.1.248.325Potri.010G118200.1.248.325
Potri.010G118200.1.248.325Potri.004G038100.2.239.318Potri.004G038100.2.239.318Potri.004G038100.2.239.318
Prunus persicappa006179m.162.339ppa006179m.162.339ppa007136m.121.216ppa007136m.121.216ppa007136m.121.216
ppa005977m.155.360ppa005977m.155.360ppa007136m.208.296ppa007136m.208.296ppa007136m.208.296
Ricinus communis29681.m001369.154.25129681.m001369.154.25129681.m001369.154.25130131.m007295.151.24830131.m007295.151.248
30131.m007295.151.24830131.m00729029851.m002360.143.23829851.m002360.143.23829729.m002350.85.186
29729.m002350.85.18630131.m007292.152.24730131.m007292.152.24729681.m001369.255.34729681.m001369.255.347
29681.m001369.255.34729729.m002350.189.28529729.m002350.189.28530131.m007292.250.34830131.m007292.250.348
29939.m00054630131.m007295.254.34130131.m007295.254.34130131.m007295.254.34139941.m000026
Setaria italicaSi029987m.141.238Si029987m.141.238Si029987m.141.238Si035904m.147.245Si035904m.147.245
Si035904m.147.245Si030323mSi029907m.152.259Si029907m.152.259Si029907m.152.259
Si036212m.163.340Si036212m.163.340Si035849m.163.341Si035849m.163.341Si030003m.159.258
Si030003m.159.258Si029907m.250.356Si029907m.250.356Si029907m.250.356Si029987m.230.331
Si029987m.230.331Si029987m.230.331Si035904m.248.325Si035904m.248.325Si035904m.248.325
Selaginella moellendorffii163627.143.240163627.143.240163627.143.24078329.125.22978329.125.229
78329.125.22986208.139.23586208.139.23583268.124.22483268.124.224
83268.124.22485032.160.36985032.160.36978263.126.21678263.126.216
78263.126.21678029.126.21678029.126.21678029.126.216163627.244.336
163627.244.336163627.244.33678329.220.32678329.220.32678329.220.326
86208.238.31886208.238.31883268.228.30983268.228.30983268.228.309
78263.225.30378263.225.30378263.225.30378029.225.30378029.225.303
78029.225.303
Sorghum bicolorSb02g042960.1.152.259Sb02g042960.1.152.259Sb02g042960.1.152.259Sb01g018410.1.143.241Sb01g018410.1.143.241
Sb01g018400.1.169.345Sb01g018400.1.169.345Sb02g010650.1Sb02g018600.1.161.265Sb02g018600.1.161.265
Sb02g018580.1Sb02g018590.1Sb02g042960.1.250.363Sb02g042960.1.250.363Sb02g042960.1.250.363
Thellungiella halophilaThhalv10013749m.132.230Thhalv10013749m.132.230Thhalv10013749m.132.230Thhalv10013789m.156.252Thhalv10013789m.156.252
Thhalv10013789m.156.252Thhalv10005987m.157.367Thhalv10005987m.157.367Thhalv10013749m.223.310Thhalv10013749m.223.310
Thhalv10013749m.223.310Thhalv10013789m.252.330Thhalv10013789m.252.330Thhalv10013789m.252.330
Vitis viniferaGSVIVT01034333001.147.339GSVIVT01034333001.147.339GSVIVT01034334001.149.247GSVIVT01034334001.149.247GSVIVT01034334001.149.247
GSVIVT01034337001.147.244GSVIVT01034337001.147.244GSVIVT01034337001.147.244GSVIVT01006484001.143.239GSVIVT01006484001.143.239
GSVIVT01006484001.143.239GSVIVT01032699001.153.253GSVIVT01032699001.153.253GSVIVT01032699001.153.253GSVIVT01034334001.251.341
GSVIVT01034334001.251.341GSVIVT01034334001.251.341GSVIVT01032699001.256.359GSVIVT01032699001.256.359GSVIVT01032699001.256.359
GSVIVT01006484001.232.320GSVIVT01006484001.232.320GSVIVT01006484001.232.320GSVIVT01034337001.236.324GSVIVT01034337001.236.324
GSVIVT01034337001.236.324
Volvox carteriVocar20008940m.118.269Vocar20008940m.118.269
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)