y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi3g31410.2
FamilyGH37
Protein PropertiesLength: 472 Molecular Weight: 52550.7 Isoelectric Point: 6.2011
ChromosomeChromosome/Scaffold: 3 Start: 33539338 End: 33543430
Descriptiontrehalase 1
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH37414680
  DPKLYVDLPLAADRAAAEAALASASASREAMEAYLARYFAAAGSDLVAVDPPDFEPEPRGFLPRVVGPGGEARAWALEVHALWKDLAREVAPDVAVRPGR
  HTLLPLPRRVVVPGSRFREVYYWDSYWVIRGLLVSKMYDTAKDIVLNLVFLVEKYGFVLNGARSYYTNRSQPPLLSSMVLEIYTATGDLGFVRRVFPSLL
  KEHSFWTSELHNVAIMDSHGLVHNLSRYQAMWNKPRPESATIDEELASKLTSTSAKEKLYHEIASAAESGWDFSSRWMSNSTDMTTLVTTFIIPVDLNTF
  ICKMERDIAVFAKLIGENATAEIFSEASKARHKAIESILWNSEMEQWLDYWLPTDGNCQGIYQWESKSQNRNIFASNFIPLWLNAHNSGFARFFDEAKSM
  RVMRSLWTSGLVHPAGIATSVSNTGQQW
Full Sequence
Protein Sequence     Length: 472     Download
MEPAAGDTDA EEGRSSSRAL LGLLQRVQSG ALRALGPANF DPKLYVDLPL AADRAAAEAA    60
LASASASREA MEAYLARYFA AAGSDLVAVD PPDFEPEPRG FLPRVVGPGG EARAWALEVH    120
ALWKDLAREV APDVAVRPGR HTLLPLPRRV VVPGSRFREV YYWDSYWVIR GLLVSKMYDT    180
AKDIVLNLVF LVEKYGFVLN GARSYYTNRS QPPLLSSMVL EIYTATGDLG FVRRVFPSLL    240
KEHSFWTSEL HNVAIMDSHG LVHNLSRYQA MWNKPRPESA TIDEELASKL TSTSAKEKLY    300
HEIASAAESG WDFSSRWMSN STDMTTLVTT FIIPVDLNTF ICKMERDIAV FAKLIGENAT    360
AEIFSEASKA RHKAIESILW NSEMEQWLDY WLPTDGNCQG IYQWESKSQN RNIFASNFIP    420
LWLNAHNSGF ARFFDEAKSM RVMRSLWTSG LVHPAGIATS VSNTGQQWLV S*            480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK13272treA3.0e-5574468408+
PRK13271treA1.0e-61142468333+
COG1626TreA3.0e-67117468365+
pfam01204Trehalase6.0e-16377468397+
PLN02567PLN02567025468453+
Gene Ontology
GO TermDescription
GO:0004555alpha,alpha-trehalase activity
GO:0005991trehalose metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABB47896.101346810465Trehalase family protein, expressed [Oryza sativa (japonica cultivar-group)]
GenBankEAZ16710.10714681376hypothetical protein OsJ_32186 [Oryza sativa Japonica Group]
RefSeqNP_001065087.101346810465Os10g0521000 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002303675.102046823470predicted protein [Populus trichocarpa]
RefSeqXP_002465049.10146835480hypothetical protein SORBIDRAFT_01g031280 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2wyn_D0142468108417A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB2wyn_C0142468108417A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB2wyn_B0142468108417A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB2wyn_A0142468108417A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB2jjb_D0142468108417A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
Metabolic Pathways
Pathway NameReactionECProtein Name
trehalose degradation II (trehalase)TREHALA-RXNEC-3.2.1.28α,α-trehalase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CJ8754032262034280
EC876828251743240
EX5795652321814120
EX5731422151813950
EX579565163984136.4
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_037_00232.1Aquca_037_00231.2Aquca_037_00231.1
Arabidopsis lyrata914188
Arabidopsis thalianaAT4G24040.1
Brachypodium distachyonBradi3g31410.3Bradi3g31410.1
Brassica rapaBra013756Bra019249
Carica papayaevm.model.supercontig_15.13
Capsella rubellaCarubv10006565m
Chlamydomonas reinhardtiiCre03.g195600.t1.2.34.224Cre03.g195600.t1.2.34.224Cre03.g195600.t1.2.267.650Cre03.g195600.t1.2.267.650
Citrus clementinaCiclev10023271mCiclev10033306mCiclev10001132mCiclev10001012mCiclev10001134m
Ciclev10000621mCiclev10000674m
Citrus sinensisorange1.1g041103m.84.216orange1.1g037772m.219.456orange1.1g037772m.219.456orange1.1g047407morange1.1g041103m.217.446
orange1.1g041103m.217.446orange1.1g037772m.86.219orange1.1g037772m.86.219orange1.1g041103m.84.216
Cucumis sativusCucsa.303880.1
Eucalyptus grandisEucgr.E01027.1Eucgr.E01027.2
Fragaria vescamrna25101.1-v1.0-hybrid
Glycine maxGlyma05g36580.2Glyma05g36580.1
Gossypium raimondiiGorai.003G075200.1Gorai.007G020500.2Gorai.007G020500.1
Linum usitatissimumLus10023035Lus10032434Lus10023034Lus10032435
Malus domesticaMDP0000315187.328.541MDP0000235673.82.325MDP0000315187.82.325MDP0000315187.82.325MDP0000235673.82.325
MDP0000235673.328.541MDP0000315187.328.541MDP0000235673.328.541
Manihot esculentacassava4.1_015916mcassava4.1_004491mcassava4.1_023202m
Mimulus guttatusmgv1a003260m
Oryza sativaLOC_Os10g37660.1
Panicum virgatumPavirv00009281mPavirv00064436mPavirv00062867mPavirv00064435m
Physcomitrella patensPp1s196_77V6.1Pp1s194_104V6.3Pp1s116_30V6.1Pp1s194_104V6.2Pp1s194_104V6.1
Pp1s137_159V6.1
Phaseolus vulgarisPhvul.002G301500.2Phvul.002G301500.1
Picea abiesMA_31368g0020MA_31368g0010
Populus trichocarpaPotri.001G087100.1Potri.003G144000.1Potri.006G068300.1Potri.003G143900.1Potri.001G087100.2
Prunus persicappa003514m
Ricinus communis28842.m00094530068.m002541
Setaria italicaSi034760m
Selaginella moellendorffii90006177119156751109304
Sorghum bicolorSb01g031280.1
Thellungiella halophilaThhalv10024684m
Vitis viniferaGSVIVT01019610001
Volvox carteriVocar20003462m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny