y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi3g33277.1
FamilyGH17
Protein PropertiesLength: 216 Molecular Weight: 24118.3 Isoelectric Point: 6.2691
ChromosomeChromosome/Scaffold: 3 Start: 35657269 End: 35657916
DescriptionGlycosyl hydrolase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1712060
  MRRLAQALKSEGFPSIRVSTPHYLGILAPSDGIPTNATFRAGYNTKLFPSMPQFHRETKPPFMVNPYPYFSYNPQTLNYTLFRPNARIYDPATKLNYTSM
  FEAQMDAIYTAMVKLGYGDVEVAIGEAGWPTQAEADQVGVGVKEAQDFNEGMLRVCSSGKGTPLMPNRTFETYLFSLFDENQKPGPVDERHFGLFNPDFT
  PVYDLR
Full Sequence
Protein Sequence     Length: 216     Download
MRRLAQALKS EGFPSIRVST PHYLGILAPS DGIPTNATFR AGYNTKLFPS MPQFHRETKP    60
PFMVNPYPYF SYNPQTLNYT LFRPNARIYD PATKLNYTSM FEAQMDAIYT AMVKLGYGDV    120
EVAIGEAGWP TQAEADQVGV GVKEAQDFNE GMLRVCSSGK GTPLMPNRTF ETYLFSLFDE    180
NQKPGPVDER HFGLFNPDFT PVYDLRLLTD GKGSV*                              240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00332Glyco_hydro_171.0e-491205210+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAX95270.101214150363glucan endo-1,3-beta-glucosidase precursor (ec 3.2.1.39) ((1-3)-beta-glucan endohydrolase) ((1-3)-beta-glucanase) (beta-1,3-endoglucanase) [Oryza sativa Japonica Group]
GenBankAAX95357.101214142355glucan endo-1,3-beta-glucosidase precursor (ec 3.2.1.39) ((1-
GenBankEEC68648.101214150363hypothetical protein OsI_37085 [Oryza sativa Indica Group]
GenBankEEE52578.101214520733hypothetical protein OsJ_34867 [Oryza sativa Japonica Group]
Swiss-ProtP5240901211140350E13B_WHEAT RecName: Full=Glucan endo-1,3-beta-glucosidase; AltName: Full=(1-
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3ur8_B1e-321207113314A Chain A, Crystal Structure Of Choline Oxidase S101a Mutant
PDB3ur8_A1e-321207113314A Chain A, Crystal Structure Of Choline Oxidase S101a Mutant
PDB3ur7_B1e-321207113314A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase
PDB3ur7_A1e-321207113314A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase
PDB1ghs_B3e-321207107306A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GT86307721212120
HX15702521112110
CJ70104721112110
GR33828921512150
CJ69900220812080
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_004_00387.1Aquca_028_00029.3.12.329Aquca_028_00029.2.24.341Aquca_028_00029.1.24.341Aquca_015_00316.1.26.346
Aquca_004_00145.5Aquca_004_00145.4Aquca_004_00145.3Aquca_004_00145.2Aquca_004_00145.1
Aquca_037_00225.1.25.339Aquca_010_00473.4Aquca_010_00473.3Aquca_010_00473.2.30.348Aquca_010_00473.1.30.348
Aquca_027_00361.1.33.346Aquca_020_00100.4Aquca_020_00100.3Aquca_020_00100.2Aquca_020_00100.1
Aquca_032_00084.5.24.343Aquca_032_00084.4.24.343Aquca_032_00084.3.25.344Aquca_032_00084.2.24.343Aquca_032_00084.1.25.344
Aquca_020_00396.2.46.363Aquca_020_00396.1.46.363Aquca_004_00387.2Aquca_013_00005.2Aquca_013_00005.1
Aquca_013_00005.3Aquca_004_00145.6Aquca_006_00019.1Aquca_003_00044.1.27.339Aquca_028_00029.4
Arabidopsis lyrata495603.28.346890866881306915975480193.25.344
493031491210351455.16.330868951480794.25.342
494762481526329002.26.344318360865962
485970.29.341321648.30.338
Arabidopsis thalianaAT4G26830.1.25.343AT5G55180.2.27.345AT5G55180.1.27.345AT5G42100.2AT5G42100.1
AT1G32860.1AT1G30080.1AT5G24318.2.30.344AT5G24318.1.30.344AT2G05790.1.25.344
AT2G27500.2AT2G27500.1AT4G18340.1AT2G16230.1.25.342AT2G26600.1
AT4G34480.1.26.343AT3G15800.1AT5G42720.1AT3G46570.1AT3G55430.1.29.341
AT2G26600.2AT2G27500.3AT2G39640.1.30.338
Brachypodium distachyonBradi3g44910.1Bradi2g23940.1Bradi5g09327.1Bradi1g38755.1Bradi3g57610.1.30.353
Bradi3g20770.1Bradi1g68450.1Bradi2g55690.1Bradi1g50080.1Bradi3g07385.1
Bradi1g53590.1Bradi4g09230.2.39.357Bradi4g09230.1.39.357Bradi1g25530.1.28.359Bradi1g25517.1.30.376
Bradi1g36460.2Bradi1g36460.1Bradi1g12810.1.31.348Bradi1g69020.1Bradi1g10347.1
Bradi1g55203.1Bradi3g33257.1Bradi5g26467.1.20.354
Brassica rapaBra035561.27.346Bra012015Bra028988.142.461Bra032357Bra028526
Bra010800Bra023293Bra013297Bra015166.25.344Bra012604
Bra002927.27.346Bra000508Bra021137Bra036510.18.332Bra033641
Bra019084.153.381Bra019084.153.381Bra000536Bra007162.28.340Bra039852.26.343
Bra007161.29.341Bra014747.29.341Bra003212.28.340Bra011537.26.342Bra027207
Bra005028.30.338Bra017659.26.265Bra017659.26.265
Carica papayaevm.model.supercontig_12.252.24.343evm.model.supercontig_3.108.23.337evm.model.supercontig_37.95evm.model.supercontig_32.24evm.model.supercontig_10.263
evm.model.supercontig_132.21.24.343evm.model.supercontig_81.143.27.339evm.model.supercontig_62.143.29.345evm.model.supercontig_36.69.30.347evm.model.supercontig_46.17
evm.model.supercontig_78.32.27.345evm.model.supercontig_1.407.27.338evm.model.supercontig_26.161.29.329
Capsella rubellaCarubv10026374m.24.342Carubv10004894mCarubv10000922m.10.324Carubv10009196mCarubv10011427m
Carubv10004986mCarubv10023375mCarubv10013604m.26.345Carubv10015799m.21.338Carubv10013884m
Carubv10026453mCarubv10018875mCarubv10017225m.33.345Carubv10023397mCarubv10025141m.30.338
Citrus clementinaCiclev10028637mCiclev10020391mCiclev10020386mCiclev10025771mCiclev10015646m
Ciclev10033472m.29.342Ciclev10015086m.33.352Ciclev10008176m.27.345Ciclev10028656mCiclev10028372m.31.346
Ciclev10020075m.31.345Ciclev10028241m.32.344Ciclev10008080m.26.344Ciclev10008555m
Citrus sinensisorange1.1g011390m.37.373orange1.1g043682morange1.1g015411morange1.1g015273morange1.1g015263m
orange1.1g041112morange1.1g017202morange1.1g016045morange1.1g009301m.93.412orange1.1g012262m.31.346
orange1.1g043079m.31.345orange1.1g012052m.26.344orange1.1g011895m.26.344orange1.1g011551m.26.344orange1.1g037583m.32.344
orange1.1g013292m.26.344orange1.1g010782m.26.344orange1.1g017408morange1.1g016232morange1.1g038452m.28.331
Cucumis sativusCucsa.319890.1Cucsa.054530.1Cucsa.109660.1.31.349Cucsa.117900.1.24.336Cucsa.193430.1
Cucsa.185070.1.26.345Cucsa.202330.1.62.376Cucsa.096380.1Cucsa.295060.2Cucsa.295060.1
Cucsa.047760.1Cucsa.165390.1.27.338Cucsa.342270.1.29.345Cucsa.042790.1.24.341Cucsa.288710.1.29.347
Cucsa.132200.1
Eucalyptus grandisEucgr.J00497.2Eucgr.J00497.1Eucgr.F03575.1.27.347Eucgr.J00494.1Eucgr.D00293.1
Eucgr.E01067.4Eucgr.E01067.3Eucgr.E01067.2Eucgr.E01067.1Eucgr.A01095.2.24.340
Eucgr.A01095.1.27.343Eucgr.B02365.1Eucgr.A01445.1.38.352Eucgr.B02367.2.28.340Eucgr.B02367.1.28.340
Eucgr.B02364.1Eucgr.F03495.1.24.340Eucgr.G00445.1.33.350Eucgr.C04236.3Eucgr.C04236.2
Eucgr.C04236.1Eucgr.C03710.1.26.344Eucgr.J03064.1Eucgr.J00013.1.24.336Eucgr.F01563.2.28.343
Eucgr.F01563.1.28.343Eucgr.F03494.1Eucgr.J00494.6Eucgr.J00494.5Eucgr.J00494.4
Eucgr.J00494.3Eucgr.J00494.2Eucgr.D01668.1
Fragaria vescamrna03446.1-v1.0-hybrid.28.345mrna15136.1-v1.0-hybrid.26.343mrna31503.1-v1.0-hybrid.26.351mrna21784.1-v1.0-hybridmrna01872.1-v1.0-hybrid
mrna30610.1-v1.0-hybridmrna12825.1-v1.0-hybrid.34.348mrna01212.1-v1.0-hybrid.27.346mrna20426.1-v1.0-hybrid.119.435mrna14081.1-v1.0-hybrid.24.337
mrna11332.1-v1.0-hybrid.26.344mrna15685.1-v1.0-hybridmrna26607.1-v1.0-hybrid.40.349mrna26603.1-v1.0-hybrid.21.329mrna31065.1-v1.0-hybrid
Glycine maxGlyma20g02240.2Glyma20g02240.1Glyma07g34500.2Glyma04g01450.1.30.347Glyma12g31060.2
Glyma12g31060.1Glyma12g09510.3Glyma12g09510.2Glyma13g39261.2Glyma13g39261.1
Glyma14g05300.1.21.338Glyma02g43640.1.21.338Glyma11g18970.2Glyma10g31550.1Glyma14g02350.1.25.343
Glyma02g46330.1.31.348Glyma06g01500.2.31.348Glyma06g01500.1.31.348Glyma15g01030.2Glyma15g01030.1
Glyma17g12180.2Glyma17g12180.1Glyma08g22670.1Glyma12g09510.5Glyma12g09510.4
Glyma15g10050.1Glyma13g22640.1Glyma07g03420.2Glyma13g29000.1Glyma05g35955.1.26.344
Glyma08g03670.1.26.344Glyma10g31550.2Glyma14g08200.3Glyma14g08200.2Glyma14g08200.1.32.350
Glyma06g07650.2Glyma18g52860.3Glyma18g52860.2.25.336Glyma18g52860.1.25.336Glyma13g44240.2
Glyma13g22640.4Glyma13g22640.3Glyma12g04800.2.96.319
Gossypium raimondiiGorai.002G114200.1.23.342Gorai.011G084000.1Gorai.008G260000.4Gorai.008G260000.3Gorai.008G260000.2
Gorai.008G260000.1Gorai.006G202300.1.76.390Gorai.007G018900.2Gorai.007G018900.1Gorai.013G263800.1.32.344
Gorai.001G216900.4.25.344Gorai.001G216900.3.25.344Gorai.001G216900.2.25.344Gorai.001G216900.1.25.344Gorai.004G128800.3
Gorai.004G128800.2Gorai.004G128800.1Gorai.004G111800.1Gorai.002G092600.2.25.343Gorai.002G092600.1.25.343
Gorai.009G154800.2Gorai.009G154800.1Gorai.010G062700.1Gorai.001G122300.4Gorai.001G122300.3
Gorai.001G122300.1Gorai.009G442700.1.27.344Gorai.009G085300.9Gorai.009G085300.6Gorai.009G085300.5
Gorai.009G085300.4Gorai.009G085300.3Gorai.009G085300.2Gorai.009G085300.1Gorai.011G044700.2
Gorai.011G044700.1Gorai.006G090600.1.24.341Gorai.005G243100.3Gorai.005G243100.2.24.341Gorai.005G243100.1.24.341
Gorai.001G043100.3Gorai.001G043100.1Gorai.004G282300.2.26.344Gorai.004G282300.1.26.344Gorai.010G078300.1.26.344
Gorai.009G085300.8Gorai.003G121900.1Gorai.009G010800.1.21.335Gorai.011G261000.1Gorai.009G202900.2.28.346
Gorai.009G202900.1.28.346Gorai.010G137300.1Gorai.009G085300.7.158.309Gorai.009G085300.7.158.309Gorai.001G122300.2
Linum usitatissimumLus10004869Lus10020618Lus10001660Lus10028122Lus10017344
Lus10011482Lus10038501Lus10023309Lus10032562.26.343Lus10015151.29.348
Lus10008277Lus10023245.26.342Lus10033244Lus10042825Lus10018306.34.352
Lus10040600.30.348Lus10004391.31.348Lus10016539.25.339Lus10023576.29.346Lus10040461.28.345
Lus10040808.26.340Lus10040294.27.340Lus10012080.28.353Lus10008865.26.339Lus10005166.23.336
Lus10004962.26.341Lus10021088Lus10023120Lus10038099Lus10006659
Lus10016032.26.349
Malus domesticaMDP0000295562.26.342MDP0000646125.28.344MDP0000759591.26.342MDP0000321387.29.360MDP0000147201
MDP0000429251MDP0000404948MDP0000399053.138.452MDP0000228686MDP0000134020
MDP0000660874.33.352MDP0000906277MDP0000480229MDP0000146863.29.346MDP0000259789
MDP0000754160.29.342MDP0000946566MDP0000282531MDP0000231454MDP0000321326.121.441
MDP0000232219.105.423MDP0000630545.27.345MDP0000283032MDP0000797451MDP0000168650
MDP0000147939MDP0000543964.23.332MDP0000676131.23.329MDP0000917991MDP0000301326
Manihot esculentacassava4.1_009801mcassava4.1_009671mcassava4.1_007570m.26.339cassava4.1_006981m.24.343cassava4.1_008551m
cassava4.1_008536mcassava4.1_006146m.34.346cassava4.1_010262mcassava4.1_006972m.24.343cassava4.1_029477m
cassava4.1_028382m.42.357cassava4.1_025555mcassava4.1_006863m.29.345cassava4.1_028137mcassava4.1_030302m.25.338
cassava4.1_007302m.26.343cassava4.1_007157m.27.343cassava4.1_007423m.26.344cassava4.1_007073m.26.344cassava4.1_005968m.34.352
cassava4.1_007509m.27.333cassava4.1_012573mcassava4.1_009600m
Medicago truncatulaMedtr1g007810.1Medtr5g085580.1.25.342Medtr3g080410.1Medtr3g116510.2.28.345Medtr3g116510.1.46.363
Medtr2g086530.1Medtr4g010200.1Medtr4g069940.1.29.346Medtr7g026340.1.23.334Medtr4g114850.2
Medtr4g114850.1Medtr4g083500.1.25.340Medtr4g053140.1
Mimulus guttatusmgv1a005776m.34.350mgv1a008187mmgv1a008785mmgv1a018482mmgv1a004780m
mgv1a005917m.28.345mgv1a006967mmgv1a006001m.26.343mgv1a026651mmgv1a020079m
mgv1a008124mmgv1a008114mmgv1a006258mmgv1a006294m.23.337mgv1a006105m.25.339
mgv1a007888m
Oryza sativaLOC_Os02g33000.1LOC_Os06g34020.1LOC_Os06g04080.2LOC_Os06g04080.1LOC_Os10g07290.1
LOC_Os03g14210.1LOC_Os04g33640.2LOC_Os04g33640.1LOC_Os01g64170.3LOC_Os01g64170.2
LOC_Os01g64170.1LOC_Os02g53200.2.29.350LOC_Os02g53200.1.54.375LOC_Os01g64170.4LOC_Os02g10660.1
LOC_Os06g40490.1LOC_Os07g13580.2LOC_Os07g13580.1LOC_Os11g47820.1.36.354LOC_Os07g35350.3.29.365
LOC_Os07g35350.2.29.365LOC_Os07g35350.1.30.366LOC_Os07g35510.1.30.367LOC_Os08g14700.1.29.366LOC_Os03g46660.1.83.400
LOC_Os03g12620.2LOC_Os03g12620.1LOC_Os05g37130.5LOC_Os05g37130.4LOC_Os05g37130.3
LOC_Os05g37130.2LOC_Os05g37130.1LOC_Os03g51240.3LOC_Os03g51240.2LOC_Os03g51240.1
LOC_Os11g47820.2.36.215LOC_Os11g47820.2.36.215LOC_Os07g35520.1.29.370LOC_Os07g35560.2.27.369LOC_Os07g35560.1.71.413
LOC_Os07g35480.3.29.366LOC_Os07g35480.2.29.366LOC_Os07g35480.1.29.366
Panicum virgatumPavirv00002381mPavirv00002380mPavirv00002379mPavirv00002378mPavirv00002377m
Pavirv00009026mPavirv00003370mPavirv00033704mPavirv00016071m.31.352Pavirv00056586m
Pavirv00041955mPavirv00067366mPavirv00023974mPavirv00060446mPavirv00002452m.31.352
Pavirv00064551mPavirv00054869mPavirv00036742mPavirv00058658mPavirv00053135m
Pavirv00062958mPavirv00046865mPavirv00038234mPavirv00034785mPavirv00064230m
Pavirv00029831m.28.350Pavirv00041735mPavirv00007211mPavirv00041823mPavirv00013502m.27.370
Pavirv00026939mPavirv00050755mPavirv00036780mPavirv00032277mPavirv00068769m
Pavirv00046871mPavirv00025664mPavirv00058680mPavirv00005661m
Physcomitrella patensPp1s150_19V6.1.38.353Pp1s51_57V6.2.37.352Pp1s51_57V6.1.37.352Pp1s6_62V6.2.25.341Pp1s6_62V6.1.25.341
Phaseolus vulgarisPhvul.002G096600.1Phvul.005G123600.1Phvul.008G213400.1.24.343Phvul.L004500.1Phvul.011G094500.1
Phvul.009G097400.1Phvul.008G271000.1.25.342Phvul.005G178000.1Phvul.009G024000.1.27.341Phvul.011G045800.1.26.343
Phvul.002G099500.1.32.348Phvul.006G165100.1Phvul.001G014900.2Phvul.001G014900.1.27.344Phvul.003G166400.1
Phvul.002G307800.1.26.344Phvul.010G155800.1Phvul.011G094500.2Phvul.008G010600.1.25.337
Picea abiesMA_107917g0010MA_67006g0010.30.344MA_82642g0010MA_83329g0010.44.358MA_21822g0010
MA_5603g0010MA_8038g0010.43.361MA_51690g0010.32.349MA_10429401g0010MA_118893g0010
MA_98924g0010MA_9997545g0010MA_10428771g0010MA_10199816g0010
Populus trichocarpaPotri.004G097400.1Potri.002G007300.1.24.344Potri.004G153800.1.24.341Potri.001G449100.5Potri.001G449100.4
Potri.001G449100.3Potri.001G449100.2Potri.001G449100.1Potri.012G017800.2.32.346Potri.012G017800.1.32.346
Potri.011G152400.2Potri.011G152400.1Potri.001G240000.2.27.339Potri.001G240000.1.27.339Potri.010G203800.1
Potri.011G084900.1Potri.014G158400.2.24.343Potri.014G158400.1.24.343Potri.015G010100.3Potri.015G010100.2
Potri.015G010100.1.33.347Potri.008G055900.4Potri.008G055900.3Potri.008G055900.2.29.342Potri.008G055900.1.29.342
Potri.002G224600.4.24.343Potri.002G224600.3.24.343Potri.002G224600.2.24.343Potri.002G224600.1.24.343Potri.009G163700.4
Potri.009G163700.3Potri.009G163700.2Potri.009G163700.1Potri.003G032600.1Potri.001G192200.3
Potri.001G192200.2Potri.001G192200.1Potri.004G202400.1Potri.004G132700.1Potri.008G056000.1.30.342
Potri.009G115400.6Potri.009G115400.4Potri.009G115400.3Potri.009G115400.2.24.340Potri.009G115400.1.24.340
Potri.011G094400.2.31.349Potri.011G094400.1.31.349Potri.002G261800.2.57.374Potri.002G261800.1.57.374Potri.014G185100.1
Potri.014G183800.2Potri.014G183800.1Potri.014G184300.1Potri.014G184100.1Potri.014G182800.1
Potri.014G182500.1Potri.014G182000.2Potri.014G182000.1Potri.014G184900.2Potri.014G184900.1
Potri.014G184600.1Potri.014G182200.1Potri.014G184200.1Potri.006G067500.1Potri.018G129500.4
Potri.018G129500.3Potri.018G129500.2Potri.018G129500.1Potri.014G183500.1Potri.005G253900.1.24.296
Potri.014G184400.1Potri.014G183000.1Potri.014G182700.1
Prunus persicappa005142m.25.355ppa007079mppa006344mppa006239mppa005206m.25.344
ppa005210m.34.351ppa007088mppa007158mppa023079m.32.346ppa004976m.25.342
ppa020393mppa005375m.27.344ppa004320m.33.346ppa1027206m.26.344ppa009389m
ppa005160m.23.322
Ricinus communis30170.m013711.23.34330055.m00156430068.m00259729753.m000250.31.34530003.m000339.28.341
29977.m000251.25.33729948.m000713.24.34329693.m00200530003.m000340.27.34029762.m000502.31.348
29912.m005363.26.34429841.m00285630170.m014027.29.34530190.m010891.28.34429927.m000621
Setaria italicaSi006581mSi019806mSi017035m.31.352Si012113mSi022277m
Si022276mSi022273mSi022272mSi033013mSi017121m
Si000941m.26.362Si001660mSi006506mSi035875mSi035755m
Si006626mSi021971m.31.348Si026317m.30.352Si000908m.29.365Si000851m.28.363
Si001233m.30.378Si035582m.30.347Si035430m.37.354Si026379mSi035791m
Si040122mSi029616m.28.384Si001793m
Selaginella moellendorffii8431110503776182438073.34.35134417
94863.17.335437861.27.33834456
Sorghum bicolorSb10g020900.1Sb04g021700.1Sb06g015590.1Sb09g021800.1Sb04g034530.1.30.351
Sb01g041160.1Sb03g040630.1Sb10g002130.1Sb01g025310.1Sb10g023710.1
Sb06g033250.1.31.347Sb02g007050.1Sb05g027690.1.31.354Sb01g012380.1.37.354Sb02g035490.1.29.379
Sb02g035520.1.25.387Sb02g035480.1.28.388Sb04g006850.1Sb01g041880.1Sb01g009770.1
Sb02g035460.4.33.370Sb02g035460.3.33.370Sb02g035460.2.33.370Sb02g035460.1.33.370
Thellungiella halophilaThhalv10013478m.27.346Thhalv10026799m.28.347Thhalv10004182m.37.351Thhalv10007753mThhalv10007671m
Thhalv10027777mThhalv10027775mThhalv10002515m.25.344Thhalv10025369mThhalv10024968m.26.343
Thhalv10016788mThhalv10016756mThhalv10003213mThhalv10022641m.41.358Thhalv10020865m
Thhalv10002343mThhalv10002342mThhalv10002341mThhalv10010363m.30.342Thhalv10008089m
Thhalv10017897m.30.338Thhalv10002844m
Vitis viniferaGSVIVT01013401001.49.369GSVIVT01038583001.24.338GSVIVT01021499001GSVIVT01036124001GSVIVT01031959001.59.377
GSVIVT01037711001.24.342GSVIVT01009700001.28.345GSVIVT01017331001GSVIVT01024956001GSVIVT01016553001.28.202
GSVIVT01016553001.28.202GSVIVT01019678001.99.280GSVIVT01019678001.99.280GSVIVT01030503001.124.253GSVIVT01030503001.124.253
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)