y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi3g37690.1
FamilyAA7
Protein PropertiesLength: 514 Molecular Weight: 55302.7 Isoelectric Point: 5.8264
ChromosomeChromosome/Scaffold: 3 Start: 40246994 End: 40249573
Descriptioncytokinin oxidase 7
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA7392329.4e-34
  LVSARPAGVAFPASADDVASFVSMAALTAHLTVAARGNGHSVAGQAMAEGGLVLDMRAVARGTQMQLVVSGAGTFVDVPGGALWEEVLHWAVSNHGLAPA
  SWTDYLRLTVGGTLSNGGVSGQSHRYGPQVSNVAELEVVTGDGKRHVCSPSSHSDLFFAVLGGLGQFGVITRARIPLSPAPQTVKWTRVVYASF
Full Sequence
Protein Sequence     Length: 514     Download
MMLAYMEHAA AATEPDQALQ LTLVADAAEC AAARDFGGLV SARPAGVAFP ASADDVASFV    60
SMAALTAHLT VAARGNGHSV AGQAMAEGGL VLDMRAVARG TQMQLVVSGA GTFVDVPGGA    120
LWEEVLHWAV SNHGLAPASW TDYLRLTVGG TLSNGGVSGQ SHRYGPQVSN VAELEVVTGD    180
GKRHVCSPSS HSDLFFAVLG GLGQFGVITR ARIPLSPAPQ TVKWTRVVYA SFAEYAADAE    240
WLVTRPAESA LDYVEGFAFV RSDDPVNGWP SVPIPGGAHF EPSLLPAGAG PVLYCLEVAL    300
YQHRHRQDDV DERMGAMMRQ LKYVRGLEFA AEVGYVEFLS RVNHVEEEAR RNGSWAAPHP    360
WLNLFISSRD IARFDATVIK GMLSDGIDGP MLVYPMLNSK WDPNTSVALP EGEIFYLVAL    420
LRFCRPYPGG PAVDELVAQN SSIIEACHAN GYDFKMYFPH YDTESDWARH FGATKWARFV    480
DRKARYDPLA ILAPGQKIFP RTPSSAAAAR VIV*                                540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR01678FAD_lactone_ox1.0e-634218188+
pfam01565FAD_binding_41.0e-2844187144+
COG0277GlcD1.0e-2937501474+
pfam09265Cytokin-bind3.0e-133219499283+
PLN02441PLN02441034506476+
Gene Ontology
GO TermDescription
GO:0008762UDP-N-acetylmuramate dehydrogenase activity
GO:0009690cytokinin metabolic process
GO:0016491oxidoreductase activity
GO:0019139cytokinin dehydrogenase activity
GO:0050660flavin adenine dinucleotide binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankADB81979.1015101515cytokinin oxidase/dehydrogenase 3 [Triticum aestivum]
DDBJBAD09964.1015031507putative cytokinin dehydrogenase [Oryza sativa Japonica Group]
GenBankEEE68814.1012450341424hypothetical protein OsJ_27576 [Oryza sativa Japonica Group]
RefSeqNP_001146838.1015071524cytokinin dehydrogenase 10 [Zea mays]
RefSeqXP_002445610.103250417511hypothetical protein SORBIDRAFT_07g022530 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2q4w_A02350241523A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct
PDB2exr_A02350241523A Chain A, X-Ray Structure Of Cytokinin OxidaseDEHYDROGENASE (CKX) FROM Arabidopsis Thaliana At5g21482
PDB3s1d_A01849924515A Chain A, Glu381ser Mutant Of Maize Cytokinin OxidaseDEHYDROGENASE COMPLEXED With N6-Isopentenyladenosine
PDB3s1c_A01849924515A Chain A, Glu381ser Mutant Of Maize Cytokinin OxidaseDEHYDROGENASE COMPLEXED With N6-Isopentenyladenosine
PDB3dq0_A01849924515A Chain A, Glu381ser Mutant Of Maize Cytokinin OxidaseDEHYDROGENASE COMPLEXED With N6-Isopentenyladenosine
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO78192450625000
EG3982742432705100
FL714394266823340
EC8753732382795070
ES791244356734260
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01436.1Aquca_002_01436.2Aquca_014_00736.1Aquca_007_00318.1Aquca_009_00356.1
Aquca_010_00588.1
Arabidopsis lyrata483228489034867825476695857642
918856480522
Arabidopsis thalianaAT2G41510.1AT5G21482.1AT3G63440.1AT1G75450.1AT1G75450.2
AT4G29740.2AT4G29740.1AT5G56970.1AT2G19500.1
Brachypodium distachyonBradi3g29130.2Bradi3g29130.1Bradi2g27170.1Bradi2g60456.1Bradi2g05580.1
Bradi3g08230.1Bradi2g06030.1Bradi1g37470.1Bradi3g08220.1Bradi2g51530.1
Brassica rapaBra016928Bra020157Bra002371Bra007743Bra000229
Bra004626Bra015842Bra040677Bra002777Bra036719
Bra035640Bra024135
Carica papayaevm.model.supercontig_182.26evm.model.supercontig_2087.1evm.model.supercontig_126.29
Capsella rubellaCarubv10022823mCarubv10018610mCarubv10000702mCarubv10026233mCarubv10013466m
Carubv10023000mCarubv10020114m
Chlamydomonas reinhardtiig9859.t1
Citrus clementinaCiclev10006491mCiclev10008441mCiclev10007999mCiclev10000709mCiclev10007992m
Ciclev10031210m
Citrus sinensisorange1.1g009956morange1.1g016403morange1.1g008291morange1.1g042782morange1.1g009793m
orange1.1g022399m
Cucumis sativusCucsa.018150.1Cucsa.231890.1Cucsa.155270.1Cucsa.299790.2Cucsa.299790.1
Cucsa.166070.1Cucsa.117040.1Cucsa.155280.1
Eucalyptus grandisEucgr.F01857.1Eucgr.G03270.1Eucgr.K01574.1Eucgr.C03157.1Eucgr.C00881.1
Eucgr.H03195.1Eucgr.C00883.1Eucgr.H03393.1Eucgr.H03190.1Eucgr.H03197.1
Fragaria vescamrna21961.1-v1.0-hybridmrna15204.1-v1.0-hybridmrna30442.1-v1.0-hybridmrna14452.1-v1.0-hybridmrna15382.1-v1.0-hybrid
mrna30654.1-v1.0-hybridmrna12649.1-v1.0-hybridmrna12648.1-v1.0-hybrid
Glycine maxGlyma09g07190.4Glyma09g07190.3Glyma09g07190.2Glyma09g07190.1Glyma14g11280.1
Glyma03g28910.2Glyma12g01390.2Glyma12g01390.1Glyma19g31620.1Glyma09g35950.1
Glyma13g16430.1Glyma11g20860.1Glyma17g06220.1Glyma17g06230.1Glyma13g16420.2
Glyma09g07360.1Glyma06g03180.1Glyma15g18560.1Glyma04g03130.1Glyma06g03180.2
Glyma17g34330.1
Gossypium raimondiiGorai.011G295400.1Gorai.012G081000.1Gorai.009G198300.4Gorai.009G198300.3Gorai.009G198300.2
Gorai.009G198300.1Gorai.013G014800.1Gorai.010G083400.1Gorai.006G134800.1Gorai.004G286300.1
Gorai.009G040700.4Gorai.009G040700.3Gorai.009G040700.2Gorai.009G040700.1Gorai.010G096700.3
Gorai.010G096700.2Gorai.010G096700.1Gorai.013G227400.1Gorai.001G012300.1Gorai.010G007500.1
Gorai.002G126300.1Gorai.013G221000.1
Linum usitatissimumLus10035433Lus10031046Lus10039574Lus10005317Lus10026471
Lus10018039Lus10016363Lus10024289Lus10003845Lus10027611
Lus10031765Lus10031188Lus10031200
Malus domesticaMDP0000223673MDP0000318353MDP0000293966MDP0000256199MDP0000250917
MDP0000238100MDP0000271354MDP0000312902MDP0000213431MDP0000211550
MDP0000279125
Manihot esculentacassava4.1_033022mcassava4.1_029100mcassava4.1_004923mcassava4.1_005650mcassava4.1_008801m
cassava4.1_005737mcassava4.1_033151m
Medicago truncatulaMedtr1g015410.1Medtr7g090920.1Medtr3g036100.1Medtr4g044110.1Medtr2g039410.1
Mimulus guttatusmgv1a004484mmgv1a022053mmgv1a004444mmgv1a004144mmgv1a004294m
Oryza sativaLOC_Os08g35860.1LOC_Os05g31040.1LOC_Os10g34230.1LOC_Os01g71310.1LOC_Os04g44230.1
LOC_Os01g09260.1LOC_Os02g12780.1LOC_Os01g10110.1LOC_Os06g37500.1LOC_Os01g56810.1
Panicum virgatumPavirv00052903mPavirv00063358mPavirv00060424mPavirv00044659mPavirv00018118m
Pavirv00028994mPavirv00031945mPavirv00035115mPavirv00059528mPavirv00068235m
Pavirv00015211mPavirv00010010mPavirv00027542mPavirv00001793m
Physcomitrella patensPp1s403_31V6.1Pp1s595_6V6.1Pp1s222_49V6.1Pp1s152_115V6.1
Phaseolus vulgarisPhvul.001G038800.1Phvul.001G128800.1Phvul.011G014000.1Phvul.005G034000.1Phvul.009G060200.1
Phvul.003G136400.1Phvul.003G136500.1Phvul.009G081800.1Phvul.009G231700.1Phvul.009G231800.1
Picea abiesMA_173695g0010MA_31778g0010MA_113618g0010MA_42031g0010MA_17212g0010
MA_138486g0010MA_32541g0010MA_23320g0010MA_10433485g0010MA_5215129g0010
MA_197101g0010
Populus trichocarpaPotri.016G044100.1Potri.006G047900.1Potri.001G020900.1Potri.003G203600.1Potri.005G232300.1
Potri.002G030500.1Potri.006G152500.1Potri.006G221000.1Potri.007G066100.1
Prunus persicappa024442mppa004120mppa003895mppb021417mppa004276m
ppa021859m
Ricinus communis29912.m00533430131.m00725529614.m00004030170.m01410329739.m003615
30169.m006344
Setaria italicaSi001018mSi021761mSi035175mSi000960mSi012051m
Si019278mSi008391mSi013710mSi013569m
Selaginella moellendorffii17472198722
Sorghum bicolorSb07g022530.1Sb09g018640.1Sb03g045410.1Sb01g019000.1Sb03g003280.1
Sb03g002810.1Sb04g007740.1Sb04g007730.1Sb06g022930.1Sb10g022590.1
Thellungiella halophilaThhalv10013259mThhalv10016470mThhalv10005878mThhalv10018378mThhalv10013271m
Thhalv10024918mThhalv10023158m
Vitis viniferaGSVIVT01001461001GSVIVT01005041001GSVIVT01009786001GSVIVT01015194001GSVIVT01028599001
GSVIVT01028610001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)