y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi3g38160.1
FamilyGT10
Protein PropertiesLength: 497 Molecular Weight: 55564.8 Isoelectric Point: 6.7329
ChromosomeChromosome/Scaffold: 3 Start: 40642717 End: 40648752
Descriptionfucosyltransferase 12
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT101453730
  VESILRSMESSQYYSENNINAARGRGYQIVMTTSLSSDVPVGYFSWAEYDIMAPVPPKTEEALAAAFISNCGARNFRLQALEMLEKLDIKIDSYGACHRN
  RDGKVDKVDTLKRYKFSLAFENSNEEDYVTEKFFQSLVTGAIPVVVGAPNIQEFSPGEGAILHIKELDDVISVARKMKHIASSPDAFNQSLRWKYDGPSD
  SFKALIDMAAVHSSCRLCIHIATKIHEKE
Full Sequence
Protein Sequence     Length: 497     Download
MKGSNSQAQA ASRRRRYVWL VPLLVGAAFL GEIAFLGRLD MSKNVAAVES WTTSFYRSSA    60
TWGVDAPPGS GHDDDGGGDD REIRQCEERL EREDAVPYDR DFERDPVLVG GAAKDWNKCS    120
VGCDFGFSAS KTPDATFGIA PDPSVESILR SMESSQYYSE NNINAARGRG YQIVMTTSLS    180
SDVPVGYFSW AEYDIMAPVP PKTEEALAAA FISNCGARNF RLQALEMLEK LDIKIDSYGA    240
CHRNRDGKVD KVDTLKRYKF SLAFENSNEE DYVTEKFFQS LVTGAIPVVV GAPNIQEFSP    300
GEGAILHIKE LDDVISVARK MKHIASSPDA FNQSLRWKYD GPSDSFKALI DMAAVHSSCR    360
LCIHIATKIH EKEERTPKFM NRPCSCSSKK GTVYHLYVRE RGRFKTESIY LRSDELTLGA    420
LESAVHAKFR SLNHVPVWKD ERPASIRGGD ELKVYRIYPI GLTERQALYK FRFSDDTELA    480
KYIKDHPCAK LEVIFV*                                                   540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00852Glyco_transf_101.0e-28175376211+
Gene Ontology
GO TermDescription
GO:0006486protein glycosylation
GO:0008417fucosyltransferase activity
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAE46648.1034962486putative glycoprotein 3-alpha-L-fucosyltransferase [Hordeum vulgare]
EMBLCAE46649.1014961487putative glycoprotein 3-alpha-L-fucosyltransferase [Triticum aestivum]
GenBankEEC83726.1014961535hypothetical protein OsI_29567 [Oryza sativa Indica Group]
RefSeqNP_001062020.1014961513Os08g0472600 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001105927.1014961498core alpha 1,3-fucosyltransferase [Zea mays]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2nzy_C0.00004209345183315A Chain A, Crystal Structure Of A Fully Functional Laccase From The Ligninolytic Fungus Pycnoporus Cinnabarinus
PDB2nzy_B0.00004209345183315A Chain A, Crystal Structure Of A Fully Functional Laccase From The Ligninolytic Fungus Pycnoporus Cinnabarinus
PDB2nzy_A0.00004209345183315A Chain A, Crystal Structure Of A Fully Functional Laccase From The Ligninolytic Fungus Pycnoporus Cinnabarinus
PDB2nzx_C0.00004209345183315A Chain A, Crystal Structure Of A Fully Functional Laccase From The Ligninolytic Fungus Pycnoporus Cinnabarinus
PDB2nzx_B0.00004209345183315A Chain A, Crystal Structure Of A Fully Functional Laccase From The Ligninolytic Fungus Pycnoporus Cinnabarinus
Transmembrane Domains
StartEnd
1736
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
JG8664882841174000
CJ5576082762224970
CB6696852792194970
EG3750012671714370
HO1291392551093630
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_015_00060.3Aquca_015_00060.1Aquca_015_00060.2
Arabidopsis lyrata891881891885479443
Arabidopsis thalianaAT3G19280.1AT1G49710.1
Brachypodium distachyonBradi3g38160.2
Brassica rapaBra014210Bra018801Bra022408
Carica papayaevm.model.supercontig_62.7
Capsella rubellaCarubv10015682mCarubv10008875m
Chlamydomonas reinhardtiig18110.t1
Citrus clementinaCiclev10028212m
Citrus sinensisorange1.1g038682m
Cucumis sativusCucsa.219830.2Cucsa.219830.1Cucsa.219830.4Cucsa.244420.1Cucsa.219830.5
Cucsa.219830.3
Eucalyptus grandisEucgr.I01147.2Eucgr.I01147.1Eucgr.I01147.3
Fragaria vescamrna28254.1-v1.0-hybrid
Glycine maxGlyma07g33580.1Glyma02g14890.1Glyma07g33580.2
Gossypium raimondiiGorai.013G044300.2Gorai.002G008200.2Gorai.008G024900.1Gorai.013G044300.1Gorai.002G008200.1
Linum usitatissimumLus10027899Lus10014060Lus10002401Lus10019855
Malus domesticaMDP0000275804MDP0000322244
Manihot esculentacassava4.1_005385mcassava4.1_009428m
Medicago truncatulaMedtr4g086010.1
Mimulus guttatusmgv1a005269m
Oryza sativaLOC_Os08g36840.1
Panicum virgatumPavirv00032486m
Physcomitrella patensPp1s31_233V6.3Pp1s31_233V6.1
Phaseolus vulgarisPhvul.003G292000.1
Picea abiesMA_100562g0010
Populus trichocarpaPotri.009G101500.3Potri.009G101500.4Potri.009G101500.1Potri.009G101500.2
Prunus persicappa004581m
Ricinus communis29801.m003181
Setaria italicaSi013627m
Selaginella moellendorffii164166
Sorghum bicolorSb07g022980.1
Thellungiella halophilaThhalv10011402m
Vitis viniferaGSVIVT01031736001
Volvox carteriVocar20004454m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny