y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi3g38500.1
FamilyGH5
Protein PropertiesLength: 539 Molecular Weight: 59901.2 Isoelectric Point: 4.8103
ChromosomeChromosome/Scaffold: 3 Start: 41005921 End: 41011074
Description
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH52134992.2e-36
  TEHRKSFVTGKDFYFLSRNSINAVRIPVGWWIAYDPDPPAPFIGGSLDTLDRAFYWAHFETASSYGGTDFEIRVYGLKCIIDLHAAPGSQNGMEHSASRD
  GSVDWPSAANIKKTLEVINFLAQRYADNPSLLGIELLNEPSADGVPLGTLVSYYKAGYKIVRSYSETAYVIFCQRIGNADPVELYQADLGPTNTVVDLHY
  YNLFDPYFEKLNATENIRFIYKDRLPQVQALSGANGPLVFIGEWVNEWNVANASQAQYQLFGKAQLEVFGEASFGWSYWTVRCNSVH
Full Sequence
Protein Sequence     Length: 539     Download
MRLPCTGVLV FCSLCVFQLS HSSSDDSFTK VRAVNLGGWL VVEGWIKPSL FDGIPNGDML    60
DGTQVQLKSV ALQKYVSAYS GGGSNVTVDR AATSSWETFK LWRVSDSEFQ FRCFNGQFLT    120
ASNGDTISAT ADSPGDPETF YIERNNTLLH IKLLNGNYLQ VTDNNQLASN YHSQPGWGDD    180
MATFEMTIVA NNLHGDYQLA NGYGPAQAKV VLTEHRKSFV TGKDFYFLSR NSINAVRIPV    240
GWWIAYDPDP PAPFIGGSLD TLDRAFYWAH FETASSYGGT DFEIRVYGLK CIIDLHAAPG    300
SQNGMEHSAS RDGSVDWPSA ANIKKTLEVI NFLAQRYADN PSLLGIELLN EPSADGVPLG    360
TLVSYYKAGY KIVRSYSETA YVIFCQRIGN ADPVELYQAD LGPTNTVVDL HYYNLFDPYF    420
EKLNATENIR FIYKDRLPQV QALSGANGPL VFIGEWVNEW NVANASQAQY QLFGKAQLEV    480
FGEASFGWSY WTVRCNSVHW DYEWNIRNRY LAGGSPLESP NYMMLVAGCV LYILSIFA*     540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00257Fascin2.0e-511117567+
pfam00150Cellulase1.0e-8233492266+
cd00257Fascin5.0e-1063173112+
COG2730BglC3.0e-22192516359+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0030674protein binding, bridging
GO:0051015actin filament binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEAZ07396.1015381537hypothetical protein OsI_29647 [Oryza sativa Indica Group]
RefSeqNP_001062079.1015191518Os08g0484100 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002262875.101052156555PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002438060.10852715527hypothetical protein SORBIDRAFT_10g007500 [Sorghum bicolor]
RefSeqXP_002533566.10155164491conserved hypothetical protein [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1eqp_A2e-2219641645252A Chain A, Exo-B-(1,3)-Glucanase From Candida Albicans
PDB3n9k_A3e-2219641650257A Chain A, F229aE292S DOUBLE MUTANT OF EXO-Beta-1,3-Glucanase From Candida Albicans In Complex With Laminaritriose At 1.7 A
PDB2pc8_A4e-2219641651258A Chain A, E292q Mutant Of Exo-B-(1,3)-Glucanase From Candida Albicans In Complex With Two Separately Bound Glucopyranoside Units At 1.8 A
Signal Peptide
Cleavage Site
22
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO0872742971384320
JG8545172652084710
DC8989053911245110
DC8992993321805110
EX3721012792445210
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_010_00111.1Aquca_010_00110.1
Brachypodium distachyonBradi2g31690.1
Carica papayaevm.model.supercontig_55.63evm.model.supercontig_66.87evm.model.supercontig_20.222
Citrus clementinaCiclev10025463mCiclev10026955mCiclev10025415mCiclev10000913m
Citrus sinensisorange1.1g009560morange1.1g046395morange1.1g019395morange1.1g013777morange1.1g010600m
orange1.1g009475m
Cucumis sativusCucsa.104180.2Cucsa.104180.1
Eucalyptus grandisEucgr.I00417.1Eucgr.L01170.1Eucgr.L02139.1Eucgr.I00543.1Eucgr.I00415.1
Eucgr.F00486.1Eucgr.F00489.1Eucgr.F00489.3Eucgr.F00489.2Eucgr.F00487.1
Eucgr.L01169.1Eucgr.F00488.1Eucgr.I00415.2
Fragaria vescamrna16220.1-v1.0-hybridmrna16368.1-v1.0-hybridmrna22085.1-v1.0-hybridmrna16374.1-v1.0-hybrid
Glycine maxGlyma11g37881.1Glyma18g01781.2Glyma18g01781.3Glyma18g01781.1Glyma06g47761.6
Glyma06g47761.1Glyma06g47761.5Glyma06g47761.2Glyma06g47761.8Glyma06g47761.4
Glyma06g47761.7Glyma06g47761.3Glyma13g02030.2Glyma06g47750.1Glyma13g02000.1
Glyma08g14676.1Glyma05g31460.1Glyma14g34450.1
Gossypium raimondiiGorai.009G239600.6Gorai.009G239600.5Gorai.009G239600.4Gorai.009G239600.1Gorai.009G239600.3
Gorai.009G239600.2Gorai.009G239600.7Gorai.011G110800.2Gorai.011G110800.1Gorai.003G041900.1
Gorai.003G044300.1Gorai.003G044000.4Gorai.003G044000.5Gorai.003G044200.1Gorai.003G044000.3
Gorai.003G044000.2Gorai.003G044000.1
Linum usitatissimumLus10041110Lus10036436
Malus domesticaMDP0000319015MDP0000123200MDP0000133367
Manihot esculentacassava4.1_007845mcassava4.1_026104mcassava4.1_006238m
Medicago truncatulaMedtr3g009020.1Medtr3g086750.1Medtr3g009030.1Medtr5g062290.1Medtr3g008960.1
Medtr5g062190.1Medtr3g009010.1Medtr8g091310.1
Mimulus guttatusmgv1a004896mmgv1a019918m
Oryza sativaLOC_Os10g22570.1.193.483LOC_Os10g22570.1.193.483LOC_Os10g22570.1.193.483LOC_Os10g22520.1LOC_Os10g22570.1.671.954
LOC_Os10g22570.1.671.954LOC_Os10g22570.1.671.954LOC_Os05g15510.2LOC_Os05g15510.1LOC_Os08g37750.1
Panicum virgatumPavirv00046245mPavirv00011301mPavirv00018291mPavirv00046244mPavirv00011300m
Pavirv00028658mPavirv00000970mPavirv00042459mPavirv00046564m
Physcomitrella patensPp1s304_43V6.1
Phaseolus vulgarisPhvul.001G254400.1Phvul.008G171300.1Phvul.002G261800.1Phvul.008G171400.1
Picea abiesMA_10427061g0010MA_479818g0010MA_4911g0010MA_14445g0010MA_23595g0010
Populus trichocarpaPotri.007G010000.1Potri.005G167800.1Potri.007G089400.1Potri.007G089400.2Potri.005G078500.1
Potri.002G093000.1
Prunus persicappa023601mppa005425mppa019648m
Ricinus communis29810.m00014529908.m00599427889.m00017327905.m00007336339.m000016
Setaria italicaSi035257mSi006205mSi021695mSi021671mSi039329m
Si013558mSi035337m
Selaginella moellendorffii12682742658240418324801
Sorghum bicolorSb10g007500.1Sb09g008170.1Sb01g024390.1Sb10g008480.1
Vitis viniferaGSVIVT01003438001GSVIVT01006372001GSVIVT01006369001GSVIVT01002801001GSVIVT01008995001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)