y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi3g40410.1
FamilyGH13
Protein PropertiesLength: 795 Molecular Weight: 88627.2 Isoelectric Point: 6.2476
ChromosomeChromosome/Scaffold: 3 Start: 42609209 End: 42616404
Descriptionisoamylase 1
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH132516360
  SSNVKHPGTFIGAVSKLDYLKELGVNCVELMPCHEFNELEYFTSSSKMNFWGYSTINFFSPMTRYASGGINNCGRDAINEFKTFVREAHKRGIEVILDVV
  FNHTAEGNENGPILSFRGIDNSTYYMLAPKGEFYNYSGCGNTFNCNHPVVREFIVDCLRYWVTEMHVDGFRFDLASIMTRGSSLWDPVNVYGDQIEGDMI
  TTGTPLVTPPLIDMISNDPILGGVKLIAEAWDAGGLYQVGQFPHWNVWSEWNGKYRDIVRQFIKGTDGFAGGFAECLCGSPHLYQAGGRKPWHSINFVCA
  HDGFTLADLVTYNNKYNIPNGENNRDGENHNLSWNCGEEGEFARLSVRRLRKRQMRNFFVCLMVSQGVPMFCMGDEYGHTKGGNNN
Full Sequence
Protein Sequence     Length: 795     Download
MHMAMTIAAQ VPCLCARPAS LAGPRLRGAA RRRPNARTAR GGARKGVGAV RAAALEAQPL    60
VEEGEDEDEE ALVEVERHAL GGACRVLAGM PGPLGATALA GGVNFAVYSG GATAAALCLF    120
TPDDLKADRV TEEVPLDPEA NRTGNVWHVF LEGGHLHDML YGYRFDGAFA PHCGQRFDAS    180
AVVVDPYAKA VVSRGEYGVP APGGECWPQM AGMIPLPYST FDWQGDLPLR YPQKDLVIYE    240
MHLRGFTKHD SSNVKHPGTF IGAVSKLDYL KELGVNCVEL MPCHEFNELE YFTSSSKMNF    300
WGYSTINFFS PMTRYASGGI NNCGRDAINE FKTFVREAHK RGIEVILDVV FNHTAEGNEN    360
GPILSFRGID NSTYYMLAPK GEFYNYSGCG NTFNCNHPVV REFIVDCLRY WVTEMHVDGF    420
RFDLASIMTR GSSLWDPVNV YGDQIEGDMI TTGTPLVTPP LIDMISNDPI LGGVKLIAEA    480
WDAGGLYQVG QFPHWNVWSE WNGKYRDIVR QFIKGTDGFA GGFAECLCGS PHLYQAGGRK    540
PWHSINFVCA HDGFTLADLV TYNNKYNIPN GENNRDGENH NLSWNCGEEG EFARLSVRRL    600
RKRQMRNFFV CLMVSQGVPM FCMGDEYGHT KGGNNNTYCH DHYVNYFRWD KKEQSSDLHR    660
FCCLMTKFRK ECECLALEDF PTAQRLQWHG HEPGKPDWSE TSRFVAFSMK DETKGEIYVA    720
FNASHLPTVV ALPERTGCRW EPVVDTGKPA PYDFLTDDLP HRAFSIHQFS HFLSSSLYPM    780
LSYSSIILVS RPDV*                                                     840
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK14510PRK145102.0e-133103737667+
PRK03705PRK037058.0e-151103650571+
cd11326AmyAc_Glg_debranch0221671456+
COG1523PulA0103766688+
TIGR02100glgX_debranch0103751701+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0043169cation binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAL31015.1037941790AF438328_1 isoamylase precursor [Triticum aestivum]
GenBankAAP44580.1037941791isoamylase wDBE-D1 [Triticum aestivum]
GenBankACM41700.1037941787isoamylase [Secale cereale]
EMBLCAC41016.20247945764isoamylase [Triticum aestivum]
EMBLCAC82925.1097942785isoamylase [Triticum aestivum]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vuy_B08974615685A Chain A, Arabidopsis Thaliana Peroxidase N
PDB2vuy_A08974615685A Chain A, Arabidopsis Thaliana Peroxidase N
PDB2vr5_B08974615685A Chain A, Arabidopsis Thaliana Peroxidase N
PDB2vr5_A08974615685A Chain A, Arabidopsis Thaliana Peroxidase N
PDB2vnc_B08974615685A Chain A, Crystal Structure Of Glycogen Debranching Enzyme Trex From Sulfolobus Solfataricus
Metabolic Pathways
Pathway NameReactionECProtein Name
starch degradation IIRXN-12280EC-3.2.1.68isoamylase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO8002352664917550
HO8002351193184360
HO800235584334900
HO4312284033697700
DV482739270793480
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00091.4Aquca_014_00091.1Aquca_014_00091.3Aquca_014_00091.2Aquca_014_00091.5
Aquca_014_00091.6Aquca_014_00091.7Aquca_018_00158.1Aquca_018_00158.2Aquca_014_00091.8
Aquca_026_00010.1
Arabidopsis lyrata911044483030470308
Arabidopsis thalianaAT4G09020.1AT2G39930.1AT1G03310.2AT1G03310.1
Brachypodium distachyonBradi4g32707.2Bradi4g32707.1Bradi3g40410.2Bradi2g26170.1
Brassica rapaBra000667Bra005001Bra030528Bra033388
Carica papayaevm.model.supercontig_36.185evm.model.supercontig_485.4evm.model.supercontig_115.45
Capsella rubellaCarubv10003443mCarubv10024947mCarubv10012076m
Chlamydomonas reinhardtiig4436.t1g3160.t1
Citrus clementinaCiclev10000452mCiclev10000347mCiclev10007489mCiclev10023436m
Citrus sinensisorange1.1g009902morange1.1g006791morange1.1g003977morange1.1g011993morange1.1g005976m
orange1.1g003653morange1.1g003901morange1.1g005552morange1.1g047308m
Cucumis sativusCucsa.311690.1Cucsa.281840.2Cucsa.281840.1Cucsa.084930.1
Eucalyptus grandisEucgr.B00043.1Eucgr.C02189.3Eucgr.C02189.2Eucgr.C02189.1Eucgr.K03392.1
Fragaria vescamrna11912.1-v1.0-hybridmrna12022.1-v1.0-hybridmrna27855.1-v1.0-hybrid
Glycine maxGlyma06g10540.2Glyma04g10693.3Glyma04g10693.2Glyma04g10693.1Glyma08g03210.2
Glyma08g03210.1Glyma03g30771.1Glyma19g33620.2
Gossypium raimondiiGorai.009G233800.1Gorai.009G233800.2Gorai.009G233800.3Gorai.012G008800.3Gorai.012G008800.2
Gorai.012G008800.1Gorai.007G134600.3Gorai.007G134600.2Gorai.007G134600.1
Linum usitatissimumLus10036474Lus10021586Lus10000661Lus10027999Lus10017150
Malus domesticaMDP0000119748MDP0000118987MDP0000313388MDP0000185233MDP0000647541
MDP0000258604MDP0000238431
Manihot esculentacassava4.1_001932mcassava4.1_001414m
Medicago truncatulaMedtr3g099500.1Medtr8g101490.1
Mimulus guttatusmgv1a002417mmgv1a001549mmgv1a001869m
Oryza sativaLOC_Os08g40930.1LOC_Os09g29404.3LOC_Os09g29404.1LOC_Os05g32710.1
Panicum virgatumPavirv00034683mPavirv00034682mPavirv00063957mPavirv00032505mPavirv00012813m
Physcomitrella patensPp1s25_63V6.1Pp1s36_254V6.2Pp1s36_254V6.1Pp1s62_201V6.2
Phaseolus vulgarisPhvul.009G033200.1Phvul.002G303600.1Phvul.001G148700.1Phvul.005G040300.1
Picea abiesMA_10431226g0020MA_159157g0180
Populus trichocarpaPotri.002G100900.2Potri.002G100900.4Potri.002G100900.3Potri.002G100900.1Potri.006G070800.3
Potri.006G070800.2Potri.006G070800.1Potri.018G132500.4Potri.018G132500.3Potri.018G132500.2
Potri.018G132500.1Potri.018G132500.5Potri.002G215400.1Potri.002G219900.1
Prunus persicappa001639mppa025097mppa001199m
Ricinus communis29908.m00608929776.m00048828153.m00028728323.m00004135877.m000015
27724.m00001829104.m000024
Setaria italicaSi029005mSi013277m
Selaginella moellendorffii10621875877414611
Sorghum bicolorSb02g027280.3Sb02g027280.2Sb02g027280.1Sb07g027200.1Sb09g019480.1
Thellungiella halophilaThhalv10028487mThhalv10028455mThhalv10028452mThhalv10016275mThhalv10006762m
Vitis viniferaGSVIVT01009087001GSVIVT01035168001GSVIVT01011096001
Volvox carteriVocar20007238mVocar20007651m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)